KEGG   Halorhabdus utahensis: Huta_2548Help
Entry
Huta_2548         CDS       T00971                                 

Definition
glyceraldehyde-3-phosphate dehydrogenase, type I (EC:1.2.1.12)
Orthology
K00134  
glyceraldehyde 3-phosphate dehydrogenase [EC:1.2.1.12]
Organism
hut  Halorhabdus utahensis
Pathway
Glycolysis / Gluconeogenesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:hut00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Huta_2548
   01230 Biosynthesis of amino acids
    Huta_2548
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Huta_2548
Enzymes [BR:hut01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.12  glyceraldehyde-3-phosphate dehydrogenase (phosphorylating)
     Huta_2548
Exosome [BR:hut04147]
 Exosomal proteins
  Proteins found in most exosomes
   Huta_2548
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2613769..2614779
Genome map
AA seq 336 aa AA seqDB search
MSASDPVRIGINGYGRIGRCTLRAALENDDVQIVGINDVMDFEKMEYLTKYDSALGTLPY
DVSLEGDSLVVDGNDIDLLNIQNPEELPWDDLDVDVAIESTGIFRTKDEASAHLDAGAEK
ALISAPPKGDKPVPQFVYGVNDDEYDGEDVVSAASCTTNSVSPPMHVLLEEFGVDAAEMT
TIHAYTGSQAIVDGPKSKTRRGRAAAENIVPTTTGASTATPDILPELEGKFEAMAIRVPV
PSGSITEIVVDLPGNPDVDEINAAFEEYAAGELEGSMGVTDDPIVSRDIVGQQFGSVVDL
GKTSTVQGGKLAKIFAWYDNEMGYTSQMMRLAEDIV
NT seq 1011 nt NT seq  +upstreamnt  +downstreamnt
atgagtgcaagcgatccggtccgcatcgggatcaacggttacggtcgaatcggccgttgt
acccttcgtgcagccctggagaacgacgacgtccagatcgtcggtatcaacgacgtaatg
gacttcgagaagatggagtatctcacgaaatacgacagcgcgttgggcaccctcccctac
gatgtctccctcgagggggactcgctggtcgtcgacggcaacgatatcgatctactcaac
atccagaaccccgaggaactcccctgggacgacctcgatgttgacgtcgcgatcgagtcg
acgggtatcttccgaacgaaggacgaggccagtgcccacctcgacgccggcgcggagaag
gcgctgatctccgccccgccgaagggcgacaagcccgtcccgcagttcgtctacggcgtc
aacgacgacgagtacgacggcgaggacgtcgtctccgccgcctcctgtacgaccaacagc
gtctcgccgccgatgcacgtcctgctggaggagttcggcgtcgacgctgccgagatgacc
acgatccacgcctacacgggcagccaggccatcgtcgacggtcccaagtccaagacccgg
cgtggtcgcgcagccgccgagaacatcgtcccgacgacgaccggcgcgtcgaccgcgacg
cccgacatcctgcccgagctcgaaggcaagttcgaggcgatggcgatccgcgtcccggtc
ccgagcggttcgatcaccgagatcgtcgtcgacctgcccggcaacccggacgtcgatgag
atcaacgccgccttcgaggagtacgcggccggcgaactcgaaggctcgatgggcgtcacc
gacgacccgatcgtctcgcgtgacatcgtgggccagcagttcggctcggtcgtcgacctg
ggcaagacctcgacggtccagggtggcaagctcgcgaagatcttcgcctggtacgacaac
gagatgggctacacgtcccagatgatgcggctggccgaagacatcgtctga

DBGET integrated database retrieval system