KEGG   Halorhabdus utahensis: Huta_2559Help
Entry
Huta_2559         CDS       T00971                                 

Definition
protein-L-isoaspartate O-methyltransferase (EC:2.1.1.77)
Orthology
K00573  
protein-L-isoaspartate(D-aspartate) O-methyltransferase [EC:2.1.1.77]
Organism
hut  Halorhabdus utahensis
Brite
Enzymes [BR:hut01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.77  protein-L-isoaspartate(D-aspartate) O-methyltransferase
     Huta_2559
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2625061..2625738
Genome map
AA seq 225 aa AA seqDB search
MGWWDSGGEGSGDGESGFERQRDELIEQLRKRERVSERALDALAAVPRHEFVPESKRRHA
YADRPLPIGEGQTISAPHMVAIMVDCLELEPGQAVLEIGTGCGYHAAVTAEVVGGENVYS
VEYHSSLAERARDRLAKLGYGDISITVGDGHDGWPEHAPYDRAYLTAAASAVPDALLDQL
RPGGIFLGPIGDRRQTLVRIQKRPDGSTERETFGGVRFVQMQGGT
NT seq 678 nt NT seq  +upstreamnt  +downstreamnt
atgggctggtgggactccggcggtgaggggtccggtgatggcgagagcggtttcgagcgc
cagcgcgacgagttgatcgagcaactccgaaagcgcgagcgcgtcagcgagcgtgcgctc
gatgccctggctgccgtccctcgccacgagttcgtccccgaaagcaaacgtcgacacgcc
tacgccgaccggccgctgccgatcggcgagggccagaccatcagtgcgccgcacatggtg
gccatcatggtcgactgcctcgaactcgaacccggccaggcggtactggagatcggtacc
ggctgtgggtatcatgcggccgtcaccgccgaggtcgtgggcggggagaacgtctacagc
gtcgagtaccattcctcactggccgagcgcgcgcgtgatcgactcgccaaactcggctat
ggggacatctcgatcactgtcggtgacggccacgacggctggcccgaacacgcgccctac
gaccgggcgtacctgaccgcggcggccagtgcagtgccggacgcgcttctcgatcagctt
cgaccgggcggaatcttcctcgggccgatcggcgaccgtcgccagacgctcgtccggatt
cagaaacgtccggatggctcgaccgaacgcgagaccttcggcggtgtgcgcttcgttcag
atgcaaggcgggacgtag

DBGET integrated database retrieval system