KEGG   Halorhabdus utahensis: Huta_2560Help
Entry
Huta_2560         CDS       T00971                                 

Definition
protein-L-isoaspartate(D-aspartate)O-methyltransferase (EC:2.1.1.77)
Orthology
K00573  
protein-L-isoaspartate(D-aspartate) O-methyltransferase [EC:2.1.1.77]
Organism
hut  Halorhabdus utahensis
Brite
Enzymes [BR:hut01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.77  protein-L-isoaspartate(D-aspartate) O-methyltransferase
     Huta_2560
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2625818..2626552
Genome map
AA seq 244 aa AA seqDB search
MDRAVLREDMVDGLRHRRESLLSEAAVASAMGTVPRHDFFDDDRTAYADRETERLGTRVL
APSTVARLFDALAPEPDDSVLIVGAGIGYTAALAAEIVGPERVHAVDITRRVVYEARENL
ATAGYDAVLVDCRDGSEGLAEYAPYDRILLEAAAVNPPRALLDQLAPDGRLVMPLGARDQ
TLVTVEGGEVCQRHGGVAFAPLLVEGEQSGAVERNRTHREDRERAQQAAQSRTGWEQDWI
DWDG
NT seq 735 nt NT seq  +upstreamnt  +downstreamnt
atggaccgggcggtgttgcgcgaggacatggtcgacgggctccgccaccggcgtgagagc
ctcctcagcgaggcagccgtggcaagtgcgatgggaactgtcccgcgccacgacttcttc
gatgacgaccgcacggcgtacgccgatcgcgagaccgagcgactcggaacgcgggttctc
gcaccgagtaccgtcgcccgactgttcgacgcgctcgcacccgaacccgacgattcggtc
ctgatcgtcggcgcaggcattggatacacggccgcgctcgcggcggagatcgtgggcccc
gagcgcgtccacgccgtcgacatcacccgccgggtggtgtacgaggctcgcgagaatctc
gccaccgccggctacgacgccgtcctcgtcgactgtcgggacggcagtgaggggctggcc
gagtacgcaccgtatgatcggattctgctcgaagcggcggcagtgaaccccccgcgcgca
ctccttgaccagctggcccccgacggccgactggtcatgcccctgggagcgcgtgaccag
acgctcgtgaccgtcgagggcggcgaagtctgtcagcgccacggtggtgtcgccttcgcc
ccgttgctcgtcgagggcgagcaaagcggtgccgtcgagcgcaaccggacccaccgcgag
gaccgcgagcgcgcccagcaagccgcccaatcgaggaccggctgggaacaggactggatc
gactgggacggctag

DBGET integrated database retrieval system