KEGG   Halorhabdus utahensis: Huta_2580Help
Entry
Huta_2580         CDS       T00971                                 

Definition
Arginase/agmatinase/formiminoglutamase
Orthology
K01480  
agmatinase [EC:3.5.3.11]
Organism
hut  Halorhabdus utahensis
Pathway
Arginine and proline metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:hut00001]
 Metabolism
  Amino acid metabolism
   00330 Arginine and proline metabolism
    Huta_2580
Enzymes [BR:hut01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.11  agmatinase
     Huta_2580
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2645159..2645983)
Genome map
AA seq 274 aa AA seqDB search
MAFPGASVDRKRADYAVVGAPLDVSTTFRPGTRFGPARVRELAATFEDYDHHTDSHFTDC
AVSDHGDVGAAGAIDDAAEYLTFLEGELDDLRADGIVPLLIGGEHTVSVAGVRSVEPDVF
VCLDAHLDLREGYAGNPLSHSTVTRHALEVADRAVILGARAGSEAEWERADEADVTVVPP
GEVSAWTPDFADESIYLSVDVDAADPGFAPGTGTMEPFGLTPREIHDVVRSVAPHAEAFD
VVEVNDRDDGQTATLAAKLLRSFVYEHATASDSE
NT seq 825 nt NT seq  +upstreamnt  +downstreamnt
atggccttccccggcgcgagtgtcgaccggaagcgtgccgactatgcggtcgtcggtgcg
ccactggacgtctcgacgacgttccggcccggtacccggtttggccccgctcgcgtccgg
gaactcgcggccaccttcgaggactacgaccaccacactgacagtcacttcaccgactgc
gccgtcagcgatcacggcgacgtcggggccgccggggcgatcgacgacgctgccgagtat
ctcacctttctggaaggcgaactcgacgacctgcgggccgacggcatcgtgcccctgctg
atcggcggcgagcacaccgtctccgtcgcgggcgtccggagcgtcgaaccggacgtcttc
gtctgtctcgacgcccatctggatctccgggagggctacgccggcaacccgttgagtcac
tcgacggtcacccgtcacgccctggaggttgccgatcgcgcggtgatcctcggggcacga
gccggcagcgaagccgagtgggagcgcgccgacgaagccgacgtgacggtcgtcccgccg
ggggaagtgagcgcgtggacacccgatttcgcggacgaatcgatctatctcagcgtcgac
gtcgacgccgccgatcccgggttcgcacccggcaccgggacgatggagcccttcggactg
acgccacgggagatccacgacgtggttcggtcggtcgccccgcacgccgaggccttcgac
gtggtcgaggtgaacgaccgcgacgacggccagaccgcgacgctggcggcgaagctccta
cgatcgttcgtctacgagcacgcaacggcgagcgacagtgagtga

  All links  
No link information was found.   
DBGET integrated database retrieval system