KEGG   Halorhabdus utahensis: Huta_2734Help
Entry
Huta_2734         CDS       T00971                                 

Gene name
gatB
Definition
aspartyl/glutamyl-tRNA amidotransferase subunit B
Orthology
K02434  
aspartyl-tRNA(Asn)/glutamyl-tRNA(Gln) amidotransferase subunit B [EC:6.3.5.6 6.3.5.7]
Organism
hut  Halorhabdus utahensis
Pathway
Aminoacyl-tRNA biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:hut00001]
 Genetic Information Processing
  Translation
   00970 Aminoacyl-tRNA biosynthesis
    Huta_2734 (gatB)
Enzymes [BR:hut01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.6  asparaginyl-tRNA synthase (glutamine-hydrolysing)
     Huta_2734 (gatB)
    6.3.5.7  glutaminyl-tRNA synthase (glutamine-hydrolysing)
     Huta_2734 (gatB)
Mitochondrial biogenesis [BR:hut03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    Huta_2734 (gatB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2802633..2804120)
Genome map
AA seq 495 aa AA seqDB search
MTAQAIQERDLTVVIGLEVHVQLETATKIFCGCSTDLEDADPNTHTCPVCLGLPGSLPVL
NEGAVEAAVRVGKAIDADIPEQTRFHRKNYYYPDLPKNFQISQYDAPICQDGELEFSVEG
ERRTVGIERAHLEEDPGSLQHAGGNIDTADYTLVNYNRAGVPLMEIVTEPDFRDATEVRA
FLAKLEEVLEYLGIFDATRDGSLRIDANLSLVDAADVDDDGSIDQDVLEDANRTEVKNIS
SHKGAQKALAYEAQRQKNAVQRGREVEQETRHWDESRGITVSMRSKEEEKDYRYFREADL
PPLEVSHWKEELSIPELPDARRERFGEEYGLNEEAASKLTTTKQVADFYEDLASEFDPDL
VATWVADELLGELNYRDMEITDVTDRLDEIERLVELVASEEITAKNARETVLRGMLDDGD
DPDTIVDREGLGKTQRDELQGAVEEAIEENPDAVSDYHDGGGGAINFLVGQVMQKTGGSA
DPGDVNQLLRAELED
NT seq 1488 nt NT seq  +upstreamnt  +downstreamnt
atgactgcccaagccattcaggaacgcgatcttaccgtcgtgatcgggctggaagtccac
gtccagctcgaaaccgcgacgaagatcttctgtggctgttcgaccgatctcgaagacgcc
gacccgaacacccacacctgcccggtgtgtctcggcctccccggatcgctaccggtactc
aacgagggggccgtcgaggccgccgtcagggttgggaaggccatcgacgccgacattccc
gagcaaacccgctttcaccggaagaactactactaccccgacctgccgaagaacttccag
atcagccagtacgacgcgccgatctgtcaggatggcgaactggaattcagtgtcgaaggc
gagcgccggacggtcgggatcgagcgcgcccacctcgaagaggaccccgggagcctccag
cacgccggcgggaacatcgacaccgccgactacacgctcgtgaactacaaccgcgccggc
gtcccgctgatggagatcgtcaccgaaccggacttccgggacgcgacggaggtccgggcc
ttcctcgcgaaactggaggaagtcctcgagtacctgggcatcttcgatgcgacgcgggac
ggctcgctccggatcgacgccaacctctcgctggtcgacgccgcggacgtcgacgacgat
ggctccatcgaccaggatgtcctcgaagacgccaaccggaccgaggtcaagaacatctcc
agtcacaaaggggcgcagaaagccctggcctacgaggcccagcgacagaaaaacgccgtt
cagcgtggccgcgaggtcgaacaggagacccgccactgggacgagtcgagggggatcacg
gtctcgatgcgctcgaaggaggaggagaaggactaccgctacttccgggaggccgacctg
ccgcccctggaggtcagccattggaaggaagagttatcgatccccgaactccccgacgcc
cgccgtgagcgtttcggcgaggaatacgggctcaacgaggaggccgcctcgaagctcacc
acgaccaagcaggtcgcggacttctacgaggacctggcaagcgagttcgatcccgatctc
gtggcgacgtgggtggccgacgaactcctgggcgaactcaactaccgcgacatggaaatc
accgacgtgacggatcgactcgacgagatcgaacgcctggtcgaactcgtcgcaagcgag
gaaatcaccgccaagaacgcccgcgagaccgtcctccgcgggatgctcgacgacggcgac
gatcccgacacgatcgtcgaccgcgagggactcggcaagacccaacgcgacgaacttcag
ggtgccgtcgaggaagctatcgaggagaaccccgacgccgtttcagactatcacgacggc
ggcggcggcgcgatcaacttcctcgtcggccaggtgatgcaaaagaccggcgggagtgcg
gatcccggtgacgtcaaccagctgttgcgggccgagctagaggactag

DBGET integrated database retrieval system