KEGG   Halorhabdus utahensis: Huta_2734Help
Entry
Huta_2734         CDS       T00971                                 

Gene name
gatB
Definition
aspartyl/glutamyl-tRNA amidotransferase subunit B
Orthology
K02434  
aspartyl-tRNA(Asn)/glutamyl-tRNA(Gln) amidotransferase subunit B [EC:6.3.5.6 6.3.5.7]
Organism
hut  Halorhabdus utahensis
Pathway
Aminoacyl-tRNA biosynthesis
Metabolic pathways
Class
Genetic Information Processing; Translation; Aminoacyl-tRNA biosynthesis [PATH:hut00970]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2802633..2804120)
Genome map
AA seq 495 aa AA seqDB search
MTAQAIQERDLTVVIGLEVHVQLETATKIFCGCSTDLEDADPNTHTCPVCLGLPGSLPVL
NEGAVEAAVRVGKAIDADIPEQTRFHRKNYYYPDLPKNFQISQYDAPICQDGELEFSVEG
ERRTVGIERAHLEEDPGSLQHAGGNIDTADYTLVNYNRAGVPLMEIVTEPDFRDATEVRA
FLAKLEEVLEYLGIFDATRDGSLRIDANLSLVDAADVDDDGSIDQDVLEDANRTEVKNIS
SHKGAQKALAYEAQRQKNAVQRGREVEQETRHWDESRGITVSMRSKEEEKDYRYFREADL
PPLEVSHWKEELSIPELPDARRERFGEEYGLNEEAASKLTTTKQVADFYEDLASEFDPDL
VATWVADELLGELNYRDMEITDVTDRLDEIERLVELVASEEITAKNARETVLRGMLDDGD
DPDTIVDREGLGKTQRDELQGAVEEAIEENPDAVSDYHDGGGGAINFLVGQVMQKTGGSA
DPGDVNQLLRAELED
NT seq 1488 nt NT seq  +upstreamnt  +downstreamnt
atgactgcccaagccattcaggaacgcgatcttaccgtcgtgatcgggctggaagtccac
gtccagctcgaaaccgcgacgaagatcttctgtggctgttcgaccgatctcgaagacgcc
gacccgaacacccacacctgcccggtgtgtctcggcctccccggatcgctaccggtactc
aacgagggggccgtcgaggccgccgtcagggttgggaaggccatcgacgccgacattccc
gagcaaacccgctttcaccggaagaactactactaccccgacctgccgaagaacttccag
atcagccagtacgacgcgccgatctgtcaggatggcgaactggaattcagtgtcgaaggc
gagcgccggacggtcgggatcgagcgcgcccacctcgaagaggaccccgggagcctccag
cacgccggcgggaacatcgacaccgccgactacacgctcgtgaactacaaccgcgccggc
gtcccgctgatggagatcgtcaccgaaccggacttccgggacgcgacggaggtccgggcc
ttcctcgcgaaactggaggaagtcctcgagtacctgggcatcttcgatgcgacgcgggac
ggctcgctccggatcgacgccaacctctcgctggtcgacgccgcggacgtcgacgacgat
ggctccatcgaccaggatgtcctcgaagacgccaaccggaccgaggtcaagaacatctcc
agtcacaaaggggcgcagaaagccctggcctacgaggcccagcgacagaaaaacgccgtt
cagcgtggccgcgaggtcgaacaggagacccgccactgggacgagtcgagggggatcacg
gtctcgatgcgctcgaaggaggaggagaaggactaccgctacttccgggaggccgacctg
ccgcccctggaggtcagccattggaaggaagagttatcgatccccgaactccccgacgcc
cgccgtgagcgtttcggcgaggaatacgggctcaacgaggaggccgcctcgaagctcacc
acgaccaagcaggtcgcggacttctacgaggacctggcaagcgagttcgatcccgatctc
gtggcgacgtgggtggccgacgaactcctgggcgaactcaactaccgcgacatggaaatc
accgacgtgacggatcgactcgacgagatcgaacgcctggtcgaactcgtcgcaagcgag
gaaatcaccgccaagaacgcccgcgagaccgtcctccgcgggatgctcgacgacggcgac
gatcccgacacgatcgtcgaccgcgagggactcggcaagacccaacgcgacgaacttcag
ggtgccgtcgaggaagctatcgaggagaaccccgacgccgtttcagactatcacgacggc
ggcggcggcgcgatcaacttcctcgtcggccaggtgatgcaaaagaccggcgggagtgcg
gatcccggtgacgtcaaccagctgttgcgggccgagctagaggactag

DBGET integrated database retrieval system