KEGG   Halorhabdus utahensis: Huta_2845Help
Entry
Huta_2845         CDS       T00971                                 

Definition
(RefSeq) acetate/CoA ligase
  KO
K01895  
acetyl-CoA synthetase [EC:6.2.1.1]
Organism
hut  Halorhabdus utahensis
Pathway
Glycolysis / Gluconeogenesis
Pyruvate metabolism
Propanoate metabolism
Methane metabolism
Carbon fixation pathways in prokaryotes
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:hut00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Huta_2845
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Huta_2845
   00620 Pyruvate metabolism
    Huta_2845
   00640 Propanoate metabolism
    Huta_2845
  Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    Huta_2845
   00680 Methane metabolism
    Huta_2845
Enzymes [BR:hut01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     Huta_2845
Lipid biosynthesis proteins [BR:hut01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   Huta_2845
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2918813..2920828)
Genome map
AA seq 671 aa AA seqDB search
MNENEDLELEARLPDQDYYRPPAKFVGGANVTDPDVYDRFDEFPDGFSEYAELLTWEERW
DETFDGSDPPFFEWFVGGSLNASVNCVDRHLAERKNQAALIWEGEGGEQRTITYQDLHRQ
VNEMAAVLREVGVEEDDVVTLHLPMVPALPITMLACARIGAVHSVVFAGFSANALADRLV
DADSDVVVSIDGYYRRGEWLDHKAKADEAVEAEETSVETALLWSRHDELHEDVELTGEDP
YVLVDDVLAGKQGAHVEPVARDAEDPLFLMYTSGTTGKPKGCQHRTGGYLAYAAGTSKYV
LDIKTTDTYWCAADIGWITGHSYIVYGPLALGTTSVMYEGTPDYPDRSRLWEIAERYDVD
IFHTSPTAIRQFMKWGEEHLAGHDFDFRHLTTVGEPIQPEAWQWYYDHVGDEDAVIVDTW
WQTETGGHLITNLPALEDMKPGSAGRPCPGIEPALYEDDGTEIEAASGRAGNLVIERPWP
GMLQTVYGDDDRFIDEYWRRFSDTDSDDWRDWVYKTGDGAVHGQDGYYRVLGRLDDVMNV
AGHRLGTMELESAVAEVEAIAEAAVVAREDRERGHVPDVYVVLRDGVEASDDVRKQVIAS
VEDEIGAFARPDRVLFVSDLPKTRSGKIMRRVLENISNKEDLGDTTTLRDPSVPDQIREQ
IQTNGGESPRS
NT seq 2016 nt NT seq  +upstreamnt  +downstreamnt
atgaacgaaaatgaagatcttgaattggaagcccggttgcccgatcaggactactatcga
ccgccggcgaagttcgtcgggggggcgaacgtcaccgaccccgacgtgtatgaccggttc
gacgagtttcccgacgggttcagtgagtacgccgagttgctcacctgggaggaacgctgg
gacgagacgttcgacgggagtgacccgccgttcttcgagtggttcgtcggcggctcgctg
aacgcctcggtcaactgcgtggaccgacacctcgcggagcgaaagaaccaggcggcactc
atctgggaaggcgaaggcggggaacagcgcacgatcacgtatcaggatctccaccggcaa
gtgaacgaaatggcggcggtcctgcgtgaggtaggcgtcgaggaggacgacgtggtcacg
ctgcacctcccgatggtcccggcgttgcccatcacgatgctcgcgtgtgcccggatcggt
gccgtccactcggtcgtcttcgcgggtttctcggcgaacgcgctggcggaccgcctcgtc
gacgcagatagtgacgttgtcgtctcgatcgacgggtattatcgtcgtggcgagtggctc
gatcacaaggcgaaggccgacgaggcggtcgaggccgaggaaaccagcgtcgaaacggca
ctgctgtggtcgcgtcacgacgaacttcacgaggacgtcgaactcaccggcgaggacccg
tacgtcctcgtcgacgatgtgctcgccggcaagcagggtgcccacgtcgaacccgtcgcc
cgcgacgccgaggaccccctctttttgatgtatacctcgggcacgacgggcaagccgaag
ggctgtcaacatcgaactgggggctacctggcgtacgccgcgggcacctcaaagtacgtc
ctcgacatcaagacgacggacacctactggtgtgcggcggacatcggctggatcaccggc
cactcctacatcgtctacggcccgctcgccctgggcacgacgagcgtcatgtacgagggg
acgccggactatccagaccgctcgcggctctgggagatcgccgagcgctacgacgtcgac
atcttccacacttcgccgacagcgatccggcagttcatgaagtggggcgaggagcacctc
gcgggccatgacttcgacttccggcacctgacgaccgtcggcgaaccgatccagcccgaa
gcctggcagtggtactacgaccatgtcggcgacgaggatgcggtcatcgtcgacacctgg
tggcagaccgagaccggcggccacctcatcaccaacctcccagccctcgaggacatgaaa
ccgggcagtgcaggccgaccgtgtcccgggatcgaaccggcactctacgaggacgacggc
acggagatcgaagcggcgagtggtcgggccggcaacctcgtgatcgagcgcccctggccg
gggatgctccagacggtctacggcgacgacgaccggttcatcgacgagtactggcggcgc
ttctcggataccgacagcgacgactggcgcgactgggtgtacaagaccggcgacggggcc
gtccacggccaggacggctactatcgcgtcctcggccggctcgacgacgtcatgaacgtc
gccggccatcgcctcgggacgatggaactggaaagcgccgtcgccgaggtcgaggcgatc
gccgaggctgccgtcgtcgcccgcgaggatcgagagcgaggacacgtcccggacgtctac
gtcgtgctcagagacggcgtcgaggccagcgacgacgtccggaagcaggtcatcgcgtcc
gtcgaggacgagatcggcgcgttcgcccgccccgatcgcgtcctgtttgtctcggatctc
ccgaagacccgctcggggaagatcatgcgtcgcgtcctcgaaaacatctcgaacaaggag
gacctcggcgatacgacgacgctccgtgacccgtccgtcccggatcagatccgcgagcaa
atccagaccaacggtggcgagtccccacgctcgtag

DBGET integrated database retrieval system