KEGG   Halorhabdus utahensis: Huta_2930Help
Entry
Huta_2930         CDS       T00971                                 

Definition
histone acetyltransferase, ELP3 family (EC:2.3.1.48)
Orthology
K07739  
elongator complex protein 3 [EC:2.3.1.48]
Organism
hut  Halorhabdus utahensis
Brite
Enzymes [BR:hut01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     Huta_2930
Transfer RNA biogenesis [BR:hut03016]
 Eukaryotic Type
  tRNA modification factors
   Elongator complex
    Huta_2930
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3016293..3017957)
Genome map
AA seq 554 aa AA seqDB search
MSTDAPEAVEDPFERACEELIERILEGDLDRDGLEAAKRDVCSKHSSPKVPKNSDLLDRA
PDGRRDELAAVVRRKPMRTASGVSPVAIMTSPERCPHGKCLYCPGGPDSEFESSQSYTGQ
EPAAARGVQNDYDPYGQVTLRLHQLRKIGHPIEKVELILMGGTMTARSHDYQEWFVKRAL
QAMNEYDPDCDPQPSETESFAQDPDAYDFRYLEDVIADNETGSIRNVATTFETKPDWCGP
EQVDRMLRLGGTKVEVGVQTTYESINREMHRGHGVDASIEANRRLRDAGFKVGFHMMPGQ
PGMTEEMVREDFRRLFEQPEWRPDYLKIYPTLVVGGTVTYDMHRRDEFEPLTSEEAAELV
ADVKPMIPEYTRLQRVQRDIPAPLIEAGVQKSNLRQLARQRMESRGESCSCIRCREVGHS
DEEPDEVTLDVEKYEVAGGTEHFISFEDRDRDLLVGFSRLRFPGEVVRPELEEAAVIREL
HVYGSEIPIGEAGEDGDDWQHQGYGKRLIERAEALAADAGYGKIAVLSGIGAREYYRDQL
GYCQDGPYVSKRLD
NT seq 1665 nt NT seq  +upstreamnt  +downstreamnt
atgagcaccgacgcgcccgaggcagtcgaggatccgttcgaacgcgcctgtgaggagttg
atcgaacggattctcgagggcgatctcgatcgcgacggcctcgaagccgccaagcgggac
gtctgctcgaagcactcctcgccgaaagtgccgaagaactcggatctgctcgaccgtgcg
ccggacggtcgccgcgatgagctggcggccgtcgtgcgtcgcaagccgatgcggaccgcc
tcgggtgtctcgccggtcgcgatcatgacctcgcccgaacgctgtccacacgggaagtgt
ctctactgcccgggcgggccggattcggagttcgagagttcccagagctacaccggccag
gaacccgccgctgctcgcggggtgcaaaacgactacgacccctacgggcaggtgacgctg
cggctccaccagctccggaagatcggccacccgatcgagaaggtcgaactcatcctcatg
ggcgggacgatgaccgcacggagtcacgactatcaggagtggttcgtcaagcgcgcgctg
caggcgatgaacgagtacgatcccgactgcgatccccagccctccgaaaccgagagcttc
gcccaggatcccgatgcgtacgacttccgctatctcgaggacgtcatcgccgacaacgag
acgggatcgatccgcaacgtcgccaccaccttcgagaccaagcccgactggtgtggcccc
gaacaggtcgaccggatgcttcggctcggcgggacgaaggtcgaggtcggcgtccagacg
acctacgagtcgatcaaccgcgagatgcaccgcggtcacggcgtcgacgcctccatcgag
gccaaccggcgtcttcgggacgcggggttcaaggtcggcttccacatgatgccgggtcag
cccggcatgaccgaggagatggtccgggaggacttccggcggctgttcgaacagcccgag
tggcggccggactacctcaagatctatccgacgctcgtcgtcggcgggaccgtcacgtac
gatatgcaccgccgcgacgagttcgaacccctcaccagcgaggaggccgccgagctcgtc
gccgacgtcaagccgatgatcccggagtacacgcgcctccagcgcgtccagcgcgatatc
cccgcgccactcatcgaggccggcgtccagaaatccaaccttcgccagctcgcccgacaa
cgcatggagtcccgcggcgagtcgtgttcgtgcatccggtgtcgagaggtcggccacagc
gacgaggaacccgatgaagtcacgctggacgtcgagaaatacgaggttgccggtggtacg
gagcacttcatcagcttcgaggatcgtgaccgggatctgctggtcgggttctcacgtctc
cggttccccggcgaggtcgtccggcccgaactcgaagaggcggctgtcatccgagagcta
cacgtctacggcagcgagatcccgatcggcgaggcaggcgaggacggcgacgactggcaa
caccagggctacgggaagcgtctcatcgagcgcgccgaggcactcgctgccgacgccggc
tacgggaaaattgccgtcctcagcgggataggcgcgcgggagtactaccgcgaccaactc
gggtattgccaggacggcccgtacgtgagcaagcgactcgattga

DBGET integrated database retrieval system