KEGG   Haloferax volcanii: HVO_0239Help
Entry
HVO_0239          CDS       T01200                                 

Gene name
glnA
Definition
glutamine synthetase (EC:6.3.1.2)
Orthology
K01915  
glutamine synthetase [EC:6.3.1.2]
Organism
hvo  Haloferax volcanii
Pathway
Alanine, aspartate and glutamate metabolism
Arginine and proline metabolism
Glyoxylate and dicarboxylate metabolism
Nitrogen metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Two-component system
Brite
KEGG Orthology (KO) [BR:hvo00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    HVO_0239 (glnA)
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    HVO_0239 (glnA)
  Energy metabolism
   00910 Nitrogen metabolism
    HVO_0239 (glnA)
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    HVO_0239 (glnA)
   00330 Arginine and proline metabolism
    HVO_0239 (glnA)
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    HVO_0239 (glnA)
Enzymes [BR:hvo01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.1  Acid-D-ammonia (or amine) ligases (amide synthases)
    6.3.1.2  glutamate---ammonia ligase
     HVO_0239 (glnA)
Exosome [BR:hvo04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   HVO_0239 (glnA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(215944..217314)
Genome map
AA seq 456 aa AA seqDB search
MTEDNALTDGGLSDEAQAVIDEIEEKNVDFLRLQFTDILGTVKNVSIPASQAEKAFTEGI
YFDGSSIDGFVRIQESDMRLEPDPSTFAVLPWRKKENSAAGRLICDVFNTSTGEPFSGDP
RGVLKRAIERAEELGYDVNVAPEPEFFLFEEDEDGRATTVTNDAGGYFDLAPKDLASDVR
RDIIYGLESMGFDIEASHHEVAEGQHEINFTYDDALSTADNVATFRSVVRAIAAEHDLHA
TFMPKPIPRINGSGMHTHISLFKDGENAFHDGDDEFDLSDTAKSFVAGILDHAPAITAVA
DPTVNSYKRLVPGYEAPVYIAWSDRNRSALIRKPAARTPAASRIEARFPDPSCNPYLAFA
ALIHAGLDGVEKGLDCPDPVRENIYEFDEAKREEYGIETLPKDLGGAVDALEEDEVIQEA
LGDHVFEKFVEAKRSEFKDYLVDVSQWELDRYLETF
NT seq 1371 nt NT seq  +upstreamnt  +downstreamnt
atgacggaagacaacgcactcaccgacggcggcctgagcgacgaggcacaggcagtcatc
gacgaaatcgaagagaagaacgtcgacttcctccgactccagttcaccgacattctcgga
acggtgaagaacgtctccatcccggcttcgcaggccgagaaggcgttcaccgagggcatc
tacttcgacggttcctccatcgacggcttcgtgcgcatccaggagtccgacatgcgcctc
gaacccgacccgtcgacgttcgccgtcctcccgtggcggaagaaggaaaacagcgccgcc
ggccgtctcatctgtgacgtgttcaacacgtccaccggcgagcccttcagcggcgacccg
cgtggcgtcctcaagcgcgctatcgagcgcgccgaggaactcggctatgacgtgaacgtc
gctcccgaaccggagttcttcctgttcgaagaagacgaagacggccgcgcgacgaccgtc
acgaacgacgccggcggctacttcgacctcgccccgaaggacctcgcgtccgacgtgcgc
cgcgacatcatctacggcctcgaaagcatgggcttcgacatcgaagcctcgcaccacgag
gtcgccgagggtcagcacgagattaacttcacgtacgacgacgccctctcgacggccgac
aacgtcgcaacgttccggtccgtcgtccgcgccatcgcggccgaacacgacctccacgcg
acgttcatgcccaagccaatcccgcgcatcaacggctccggcatgcacacgcacatctcg
ctgttcaaggacggcgagaacgcgttccacgacggcgacgacgagttcgacctgagcgac
acggccaagagcttcgtcgcgggcatcctcgaccacgcgcccgccatcacggcggtcgct
gacccgacggtcaactcctacaagcgcctcgtccccggctacgaagcgccggtctacatc
gcgtggtccgaccgcaaccgctcggcgctcatccgcaagccggccgcccgcacgccggcc
gcctcgcgcatcgaggcccgcttccccgacccgtcctgtaacccgtacctcgcgttcgcc
gcgctcatccacgccggtctcgacggcgtcgagaagggcctcgactgccccgacccggtc
cgcgagaacatctacgagttcgacgaggcaaagcgcgaagagtacggcatcgagacgctc
ccgaaggacctcggcggcgccgtcgacgccctcgaagaggacgaagtcatccaggaggcc
ctgggcgaccacgtcttcgagaagttcgtcgaagccaagcgctccgagttcaaggactac
ctcgtcgacgtctcccagtgggagctcgaccggtacctcgagacgttctaa

DBGET integrated database retrieval system