KEGG   Haloferax volcanii: HVO_0403Help
Entry
HVO_0403          CDS       T01200                                 

Gene name
glcK
Definition
glucokinase
Orthology
K00845  
glucokinase [EC:2.7.1.2]
Organism
hvo  Haloferax volcanii
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:hvo00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    HVO_0403 (glcK)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    HVO_0403 (glcK)
   00052 Galactose metabolism
    HVO_0403 (glcK)
   00500 Starch and sucrose metabolism
    HVO_0403 (glcK)
   00520 Amino sugar and nucleotide sugar metabolism
    HVO_0403 (glcK)
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    HVO_0403 (glcK)
   00524 Butirosin and neomycin biosynthesis
    HVO_0403 (glcK)
Enzymes [BR:hvo01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     HVO_0403 (glcK)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
358032..359000
Genome map
AA seq 322 aa AA seqDB search
MAYYVGVDLGATNVRSVVGDDDGTVLGEARDNTPRGPTGIAVTEAVLGVVREACAEAGID
PSDAVAAGIGAIGPLDLAEGAVENPANLPDTIDRIPLTGPLSVLLETDEVYLHNDTNAGV
IGERFHSDRNPDDMVYLTISSGIGAGVCVDGHVLAGWDGNAGEVGHLTLDPHGFMTCGCG
HNGHWEGYCSGNNIPKYARELHEEDPVDTALPISDPDFSAVDVFEHAGDDEFADHIISQL
GHWNAMGVANIVHAYAPLIIYVGGAVALNNPDLVLEPIREQMSEMVMSNIPEIQLTTLGD
EVVVEGALASAMTGGTGDRSRL
NT seq 969 nt NT seq  +upstreamnt  +downstreamnt
atggcgtactacgtgggcgtcgacttgggggcgacgaacgtccgttccgtggtcggcgac
gacgatggaaccgtcctcggagaggcccgtgacaacactccgcgcggcccgacgggaatc
gcggtcaccgaggcggtcctcggcgtcgtccgcgaggcgtgtgccgaggcgggcatcgac
ccgagcgacgcggtcgcggccggtatcggtgcaatcggcccgctcgacttggccgagggc
gcggtcgaaaacccggcgaacctcccggacaccatcgaccgcatcccgctgaccggtccc
ctttcggtgctgttggagacggacgaggtgtacctgcacaacgacacgaacgccggcgtc
atcggcgagcggttccactccgaccgcaaccccgacgacatggtgtacctcaccatctcc
tccggtatcggcgcgggggtctgcgtcgacgggcacgtcctcgccggctgggacggcaac
gccggcgaggtcggccacctgacgctcgacccgcacggcttcatgacgtgcggctgcggc
cacaacggtcactgggagggctactgctcggggaacaacatcccgaagtacgcccgcgaa
ctccacgaggaagacccggtcgacaccgcgctccccatctccgaccccgacttctccgcg
gtcgacgtgttcgaacacgccggcgacgacgagttcgcagaccacatcatcagccaactg
ggccactggaacgcgatgggcgtcgccaacatcgtccacgcgtacgcgccgcttatcatc
tacgtcggcggcgcggtcgcgctcaacaacccggacctcgtgttggagcccatccgcgaa
cagatgagcgagatggtcatgtcgaacatccccgagattcaactgacgacgctgggcgac
gaggtcgtggtcgagggggcgttggcgagcgcgatgaccggtggaactggcgaccgctcg
cggctgtga

DBGET integrated database retrieval system