KEGG   Haloferax volcanii: HVO_0474Help
Entry
HVO_0474          CDS       T01200                                 

Gene name
pimT1
Definition
protein-L-isoaspartate O-methyltransferase 2 (EC:2.1.1.77)
Orthology
K00573  
protein-L-isoaspartate(D-aspartate) O-methyltransferase [EC:2.1.1.77]
Organism
hvo  Haloferax volcanii
Brite
Enzymes [BR:hvo01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.77  protein-L-isoaspartate(D-aspartate) O-methyltransferase
     HVO_0474 (pimT1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(422870..423604)
Genome map
AA seq 244 aa AA seqDB search
MDNSVLRDDMVDGLEHSLELLPEAVSIAMRSVPRHEFVTDSPYQNRPTEHRDTNTTILAP
TTVARLLAALDPQPDDEVLVVGAGVGYTAAVLAEIVGDARVHAVDITRSLVYEARENLQR
AGYGGVLVDCRDGAEGLADYAPFDRILVEASAVRPPARLLAQLADGGRLVMPKGVGEQTL
VAVEDGEVAESFGPLSFKPLLVDGEQTGSIVRNRTRREDPEYEGRGWHAGHGWEQDWIDW
GGSG
NT seq 735 nt NT seq  +upstreamnt  +downstreamnt
atggacaactcggtgctgcgcgacgacatggtcgacggcttggagcactcgctggagttg
ctcccggaggccgtctccatcgccatgcgcagcgtcccgcgacacgagttcgtcaccgac
tcgccgtatcagaaccgcccgacggagcaccgcgacacgaacacgaccatcctcgcgccg
acgacggtcgcgcgcctgctcgccgcgctcgacccccaaccggacgacgaggtgctcgtc
gtcggcgcgggcgtcggctacaccgccgcggtcctcgccgaaatcgtcggcgacgcccgc
gtccacgcggtcgacatcacgcgctcgctcgtctacgaggcgcgcgagaacctccagcgc
gccggctacggcggcgtcctcgtggactgccgcgacggcgcggaggggctggccgactac
gcgcccttcgaccgcatcctcgtcgaggcctcggcggtccgcccgcccgcgcgactcctc
gcacagctcgctgacggcggccgactcgtcatgccgaagggcgtcggcgagcagacgctc
gtcgccgtcgaggacggcgaagtggccgagtcgttcggcccgctgtcgttcaagccgctg
ctcgtcgacggcgaacagaccggaagcatcgtcagaaaccggacgcgccgcgaggacccc
gagtacgagggtcgcggctggcacgccggccacggttgggaacaggactggatagactgg
ggcggcagcgggtag

DBGET integrated database retrieval system