KEGG   Haloferax volcanii: HVO_0478Help
Entry
HVO_0478          CDS       T01200                                 

Definition
type II glyceraldehyde-3-phosphate dehydrogenase (EC:1.2.1.59)
Orthology
K00150  
glyceraldehyde-3-phosphate dehydrogenase (NAD(P)) [EC:1.2.1.59]
Organism
hvo  Haloferax volcanii
Pathway
Glycolysis / Gluconeogenesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:hvo00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    HVO_0478
   01230 Biosynthesis of amino acids
    HVO_0478
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    HVO_0478
Enzymes [BR:hvo01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.59  glyceraldehyde-3-phosphate dehydrogenase (NAD(P)+) (phosphorylating)
     HVO_0478
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
426605..427672
Genome map
AA seq 355 aa AA seqDB search
MIRVGVNGYGTIGKRVADAVHAQPDMELIGVAKTQPNFEAHTAGERGYPMYAAIPERSPL
FSEAGVDLAGEVDELVAKADIIVDCTPSGIGAENRELYETHHTPAIFQGGEDADVADVSF
NARANFDAARDADYVRVVSCNTTGLSRIIAPLEAEYGVEKVRATLVRRGGDPGQNSRGPI
NDILPNPIEIPSHHGPDVKTIFPGLEIDTLGLKVPATLMHVHALNVTLEDDVTGAHVRQL
LEGENRVYVIPEGMGIDGAGKLMDFALDAGRPRGDMWENCVWGESIGVNGRDLYLFQAIH
QQSDVIPENVDAIRAMFDTEDQQDSMALTDRTLGIGISGDPSGFSEQARAEFADD
NT seq 1068 nt NT seq  +upstreamnt  +downstreamnt
atgatacgagtgggtgtcaacggctacggcacaatcggaaagcgcgtcgccgacgcggtc
cacgcgcagcccgacatggaactcatcggcgtggccaagacccagcccaacttcgaagcg
cacaccgcgggcgaacgcggctacccgatgtacgccgcgattcccgaacgctcgccgctg
ttctccgaggccggcgtcgacctcgccggcgaggtggacgaactggttgccaaggcggac
atcatcgtcgactgcacgccgtcgggcatcggagcagagaaccgcgaactgtacgagacg
caccacacgcccgccatcttccaggggggcgaggacgccgacgtggccgacgtgagcttc
aacgcgcgggccaacttcgacgccgcccgcgacgccgactacgtccgcgtcgtctcctgt
aacacgaccggcctctcgcgcatcatcgcgccgctcgaagccgagtacggcgtcgagaag
gttcgggcgacgctcgtccgccgcggcggcgaccccggccagaactcccgcgggccgata
aacgacatcctgccgaacccaatcgagattccgtcgcaccacggccccgacgtgaagacc
atcttccccggcctcgaaatcgacacgctcgggctgaaggtgccggcgacgctgatgcac
gtccacgcgctcaacgtcacgctcgaagacgacgtgaccggcgcgcacgtccgccaactg
ctcgaaggcgagaaccgcgtctacgtcatccccgaggggatgggcatcgacggcgcgggc
aagctcatggacttcgcgctcgacgcgggccgcccgcgcggcgacatgtgggagaactgc
gtgtggggcgagtccatcggcgtcaacggccgcgacctctatctgttccaggccatccac
cagcagtccgacgtgattcccgagaacgtcgacgctatccgcgcgatgttcgacaccgaa
gaccagcaggacagcatggcgctcaccgaccggacgctcggcatcggcatctccggcgac
ccttctgggttctctgagcaggcgcgcgcggagttcgccgacgactaa

DBGET integrated database retrieval system