KEGG   Haloferax volcanii: HVO_0478Help
Entry
HVO_0478          CDS       T01200                                 

Definition
(GenBank) glyceraldehyde-3-phosphate dehydrogenase, type II
  KO
K00150  glyceraldehyde-3-phosphate dehydrogenase (NAD(P)) [EC:1.2.1.59]
Organism
hvo  Haloferax volcanii
Pathway
hvo00010  Glycolysis / Gluconeogenesis
hvo01100  Metabolic pathways
hvo01110  Biosynthesis of secondary metabolites
hvo01120  Microbial metabolism in diverse environments
hvo01130  Biosynthesis of antibiotics
hvo01200  Carbon metabolism
hvo01230  Biosynthesis of amino acids
Module
hvo_M00002  Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:hvo00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    HVO_0478
Enzymes [BR:hvo01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.59  glyceraldehyde-3-phosphate dehydrogenase (NAD(P)+) (phosphorylating)
     HVO_0478
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Gp_dh_C DapB_N Gp_dh_N NAD_binding_3 2-Hacid_dh_C GFO_IDH_MocA
Motif
Other DBs
NCBI-ProteinID: ADE04891
UniProt: D4GS18
Position
426605..427672
Genome map
AA seq 355 aa AA seqDB search
MIRVGVNGYGTIGKRVADAVHAQPDMELIGVAKTQPNFEAHTAGERGYPMYAAIPERSPL
FSEAGVDLAGEVDELVAKADIIVDCTPSGIGAENRELYETHHTPAIFQGGEDADVADVSF
NARANFDAARDADYVRVVSCNTTGLSRIIAPLEAEYGVEKVRATLVRRGGDPGQNSRGPI
NDILPNPIEIPSHHGPDVKTIFPGLEIDTLGLKVPATLMHVHALNVTLEDDVTGAHVRQL
LEGENRVYVIPEGMGIDGAGKLMDFALDAGRPRGDMWENCVWGESIGVNGRDLYLFQAIH
QQSDVIPENVDAIRAMFDTEDQQDSMALTDRTLGIGISGDPSGFSEQARAEFADD
NT seq 1068 nt NT seq  +upstreamnt  +downstreamnt
atgatacgagtgggtgtcaacggctacggcacaatcggaaagcgcgtcgccgacgcggtc
cacgcgcagcccgacatggaactcatcggcgtggccaagacccagcccaacttcgaagcg
cacaccgcgggcgaacgcggctacccgatgtacgccgcgattcccgaacgctcgccgctg
ttctccgaggccggcgtcgacctcgccggcgaggtggacgaactggttgccaaggcggac
atcatcgtcgactgcacgccgtcgggcatcggagcagagaaccgcgaactgtacgagacg
caccacacgcccgccatcttccaggggggcgaggacgccgacgtggccgacgtgagcttc
aacgcgcgggccaacttcgacgccgcccgcgacgccgactacgtccgcgtcgtctcctgt
aacacgaccggcctctcgcgcatcatcgcgccgctcgaagccgagtacggcgtcgagaag
gttcgggcgacgctcgtccgccgcggcggcgaccccggccagaactcccgcgggccgata
aacgacatcctgccgaacccaatcgagattccgtcgcaccacggccccgacgtgaagacc
atcttccccggcctcgaaatcgacacgctcgggctgaaggtgccggcgacgctgatgcac
gtccacgcgctcaacgtcacgctcgaagacgacgtgaccggcgcgcacgtccgccaactg
ctcgaaggcgagaaccgcgtctacgtcatccccgaggggatgggcatcgacggcgcgggc
aagctcatggacttcgcgctcgacgcgggccgcccgcgcggcgacatgtgggagaactgc
gtgtggggcgagtccatcggcgtcaacggccgcgacctctatctgttccaggccatccac
cagcagtccgacgtgattcccgagaacgtcgacgctatccgcgcgatgttcgacaccgaa
gaccagcaggacagcatggcgctcaccgaccggacgctcggcatcggcatctccggcgac
ccttctgggttctctgagcaggcgcgcgcggagttcgccgacgactaa

DBGET integrated database retrieval system