KEGG   Haloferax volcanii: HVO_0481Help
Entry
HVO_0481          CDS       T01200                                 

Gene name
gap
Definition
(GenBank) glyceraldehyde-3-phosphate dehydrogenase, type I
  KO
K00134  glyceraldehyde 3-phosphate dehydrogenase [EC:1.2.1.12]
Organism
hvo  Haloferax volcanii
Pathway
hvo00010  Glycolysis / Gluconeogenesis
hvo01100  Metabolic pathways
hvo01110  Biosynthesis of secondary metabolites
hvo01120  Microbial metabolism in diverse environments
hvo01130  Biosynthesis of antibiotics
hvo01200  Carbon metabolism
hvo01230  Biosynthesis of amino acids
Module
hvo_M00002  Glycolysis, core module involving three-carbon compounds
hvo_M00308  Semi-phosphorylative Entner-Doudoroff pathway, gluconate => glycerate-3P
Brite
KEGG Orthology (KO) [BR:hvo00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    HVO_0481 (gap)
Enzymes [BR:hvo01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.12  glyceraldehyde-3-phosphate dehydrogenase (phosphorylating)
     HVO_0481 (gap)
Membrane trafficking [BR:hvo04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Selective cargos
    HVO_0481 (gap)
Exosome [BR:hvo04147]
 Exosomal proteins
  Proteins found in most exosomes
   HVO_0481 (gap)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Gp_dh_C Gp_dh_N DapB_N Semialdhyde_dhC NAD_binding_3
Motif
Other DBs
NCBI-ProteinID: ADE03163
UniProt: D4GS21
Position
complement(429927..430979)
Genome map
AA seq 350 aa AA seqDB search
MSEKSYLSAGENVDESDVVRVALNGFGRIGRNIFRAVLDNPKVELVAINDVMDFDDMAYL
AKYDSVMGRLDGVERDGDSLSIGGTSVSLYNVQSPAELPWGELDVDVALECTGIFRTKED
ASAHLEAGADKVVISAPPKGDEPVKQIVYGVNHDEYDGEDIVSNASCTTNSVTPVAKVLD
EEFGIENGLLTTVHAYTGSQNLIDSPHAKQRRGRAAAENIVPTTTGAAQAATEILPQLDG
KLDGMAIRVPVPNGSLTELVVRLEDKPSVEEINDAFRAAADSGPLAGVLGYTDDEVTSRD
ILGLPFSSTVDLNTTNQVNDGGLYKILTWYDNEYGFSNRMLDVAHFVTHQ
NT seq 1053 nt NT seq  +upstreamnt  +downstreamnt
atgagtgaaaaatcctacctcagcgcgggcgagaacgtggatgaatcggacgtggtgcgg
gtggcactcaacggcttcggccgcatcggccggaacatcttccgtgccgtcctcgacaac
ccgaaggtcgaactggtcgccatcaacgacgtcatggacttcgacgacatggcgtatctc
gcgaagtacgactccgtcatgggccggctcgacggcgtcgagcgagacggcgactcgctg
tccatcggcggcacctcggtgagcctctacaacgtccagtcccccgcggagcttccgtgg
ggcgaactcgacgtggacgtggcgctcgaatgtacgggcatcttccgtacgaaggaagac
gcctccgcacacctcgaagcgggcgcggacaaggtcgtcatctccgcgccgccgaagggc
gacgagccggtcaagcagatcgtctacggcgtcaaccacgacgagtacgacggcgaggac
atcgtctcgaacgcctcctgtacgaccaactccgtcacgccggtcgcgaaggtgctcgac
gaggagttcggcatcgagaacggtctcctgacgaccgtccacgcctatacgggcagccag
aacctcatcgacagcccccacgcgaaacagcgccgcgggcgtgccgccgccgagaacatc
gtcccgacgacgaccggcgcggcgcaggcggccaccgagattctgccccagctcgacggc
aagctcgacggcatggcgattcgcgtccccgtgccgaacggctcgctcaccgagctcgtc
gtccgtctcgaagacaagccctccgtcgaggagattaacgacgccttccgcgccgcggcc
gactccggcccgctcgcgggcgtcctcggctacacggacgacgaggtcacctcgcgtgac
atcctcggcctgccgttctccagcaccgtcgacctcaacacgaccaaccaggtcaacgac
ggcggcctctacaagatactgacgtggtacgacaacgagtacggcttctccaaccggatg
ctcgacgtcgcccacttcgtcacccaccagtag

DBGET integrated database retrieval system