KEGG   Haloferax volcanii: HVO_0666Help
Entry
HVO_0666          CDS       T01200                                 

Definition
dihydrolipoamide S-acyltransferase (EC:2.3.1.-)
Orthology
K00627  
pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
hvo  Haloferax volcanii
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:hvo00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    HVO_0666
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    HVO_0666
   00020 Citrate cycle (TCA cycle)
    HVO_0666
   00620 Pyruvate metabolism
    HVO_0666
Enzymes [BR:hvo01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     HVO_0666
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
594094..595581
Genome map
AA seq 495 aa AA seqDB search
MAYVVKMPKLGLEMKSGELSAWLVSEGDEVTEGDPIAEIESEKTTAEIDAKEDGVLRRVV
LAEGESTAPGGALAIVAGADEDISGLEADAGVGEGGSEPVATDDSAGDSSPTEVTETTET
AATGGGDASSVAQSRSRGSDGASENGEVRASPRAKRLADDLGVDLTTVEGTGPQGAITES
DVETAAESATATAAEKRVFAPPSARRLARELGVDIEAVEGTGQNGRITESDVRAAGGATA
AATDSSAAGAATTAATDATAASEPAETERPLSGMRRTIADRLGESYREAVHVTVDRRADA
EELLAAANAAADALGVDVSITDVLLLALSASLDEHPEFNATFEDGVHRLHGEHNVCIAVD
VDEGLIAPVVRDVASLSLSELAETRAETTQRALSGDFTMDDLSGGTFTVSNLGVLGVESF
DPIINPPQVAILGVNTIRREAVPTDDGDVAVRRVISFSLSFDHRIVDGADAARMLGTLVE
HVENPWPLVIAAGGR
NT seq 1488 nt NT seq  +upstreamnt  +downstreamnt
atggcgtacgtagtcaagatgcccaaactggggttagagatgaagtccggcgagctctcg
gcgtggctcgtctcggagggcgacgaggtcaccgagggcgatccaatcgccgaaatcgag
tcggagaagacgaccgcggagatagacgccaaggaagacggcgttctgcggcgcgtcgtt
ctcgcggaaggcgagtcgacagcgcccggcggcgcgctggcaatcgtcgccggcgcggac
gaggacatctccggtttggaagctgacgcgggcgtcggtgagggcgggagcgaacccgtc
gcgacagacgactccgcgggcgactcgtccccgaccgaggtgaccgagacgacggagacg
gcggcgaccggcggcggggacgcttcgtcggtcgcgcagtcgcgctcgcgcgggtcggac
ggggcgtcggagaacggcgaggtgcgcgcgtcgccgcgagcgaagcgactcgcggacgac
ctcggggtcgacctcacgaccgtcgaaggcaccgggccgcagggcgcaatcaccgagagc
gacgtggaaaccgcggccgaatccgcgaccgcgaccgcggccgaaaaacgcgtgttcgcc
ccgccgagcgcccgccgcctcgcccgcgaactcggcgtcgacatcgaggccgtcgagggg
acgggacagaacggccgcatcaccgagtccgacgtgcgggcggcgggcggcgcgaccgcg
gcggcgaccgactcgtcggccgccggagccgccacgaccgctgcgactgacgcgactgcc
gcgagcgaaccggccgaaacggagcggccgctatccgggatgcgccgcaccatcgccgac
cgcctcggcgagagctaccgcgaggcggtccacgtcacggtcgaccgccgcgccgacgcg
gaggaactgttggccgcggcgaacgccgccgccgacgctctcggcgtggacgtgtcgata
acggacgtcctgctcctcgcgctctcggcgtcgctcgacgagcaccccgagttcaacgcg
accttcgaggacggcgtccacaggctccacggggaacacaacgtctgcatcgcggtcgac
gtcgacgaggggctcatcgcaccggtcgtccgcgacgtggcctcgctgtcgctttccgaa
ctcgccgagactcgcgccgagaccactcagcgggcgctgtcgggcgacttcacgatggac
gacctctcgggggggacgttcaccgtctcgaacctcggcgtcctcggcgtcgagtcgttc
gacccgataatcaacccgccgcaggtcgccatcctcggcgtcaacacgattcgccgggag
gccgtgccgaccgacgacggcgacgtggccgtccggcgggtcatctcgttttcgctgtcg
ttcgaccaccgcatcgtcgacggggcggacgccgcccgcatgctcggcacgctcgtcgaa
cacgtcgagaacccgtggccgctcgtcatcgccgccggcggacggtga

DBGET integrated database retrieval system