KEGG   Haloferax volcanii: HVO_0787Help
Entry
HVO_0787          CDS       T01200                                 

Gene name
trpC
Definition
(GenBank) indole-3-glycerol-phosphate synthase
  KO
K01609  indole-3-glycerol phosphate synthase [EC:4.1.1.48]
Organism
hvo  Haloferax volcanii
Pathway
hvo00400  Phenylalanine, tyrosine and tryptophan biosynthesis
hvo01100  Metabolic pathways
hvo01110  Biosynthesis of secondary metabolites
hvo01130  Biosynthesis of antibiotics
hvo01230  Biosynthesis of amino acids
Module
hvo_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:hvo00001]
 Metabolism
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    HVO_0787 (trpC)
Enzymes [BR:hvo01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.48  indole-3-glycerol-phosphate synthase
     HVO_0787 (trpC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: IGPS QRPTase_C NanE His_biosynth DHO_dh FMN_dh ThiG
Motif
Other DBs
NCBI-ProteinID: ADE03107
UniProt: P18304
Position
706709..707464
Genome map
AA seq 251 aa AA seqDB search
MNASGDELAPDVRAILEAARERPGGETRVSVDARSFPEAVAETEAAGRVPVIAEVKPTSP
TTEGVREDDPVELAREMVAGGATALSVLTEPEHFGGSAESLRRIREAVDVPVLRKDFIMN
EAQLDVVQSDLVLLIARFVGEDLPALVEAARDRGFQPLVEVHTREELTAALAAGADIVGI
NNRDLGKLEVDLGTFEELAPEAPEDVLLVAESGVQTVDDARRMREAGADALLVGTAIMDG
DVRQNTETLTQ
NT seq 756 nt NT seq  +upstreamnt  +downstreamnt
atgaacgctagtggagacgaattagctcccgacgtgcgcgccatcttggaggccgcgcgg
gagcgacccggcggggagacgcgcgtgtcggtcgacgcgcggtcgttccccgaggccgtg
gccgagacggaggccgcgggtcgggtccccgtcatcgccgaggtgaagcccacgagtccg
acgaccgagggcgtccgcgaggacgacccggtcgaactggcccgcgagatggtcgccggc
ggcgcgacggcgctgtcggtcctcaccgaacccgagcacttcggaggctccgccgagtcg
ctgcggcgcatccgcgaggccgtcgacgtgcccgtgctccgcaaggacttcatcatgaac
gaggcccaactggatgtcgtccagtccgacctcgtgctcctcatcgcgcggttcgtcggc
gaggacctcccggccctcgtcgaggcggcccgcgaccgcggcttccagccgctcgtggag
gtccatacgcgcgaggaactcacggcggcgctcgcggccggtgccgacatcgtcggcatc
aacaaccgcgacctcgggaagctggaagtcgacctcggcacgttcgaggaactcgcgccc
gaagcgcccgaggacgtgcttctcgtggccgaaagcggcgtgcagacggtcgacgacgcg
cggcggatgcgcgaggccggtgccgacgccctcctcgtcgggaccgccatcatggacggc
gacgtgcgacagaacacggagacactcacacaatga

DBGET integrated database retrieval system