KEGG   Haloferax volcanii: HVO_0788Help
Entry
HVO_0788          CDS       T01200                                 

Gene name
trpB
Definition
(GenBank) tryptophan synthase beta subunit
  KO
K01696  tryptophan synthase beta chain [EC:4.2.1.20]
Organism
hvo  Haloferax volcanii
Pathway
hvo00260  Glycine, serine and threonine metabolism
hvo00400  Phenylalanine, tyrosine and tryptophan biosynthesis
hvo01100  Metabolic pathways
hvo01110  Biosynthesis of secondary metabolites
hvo01130  Biosynthesis of antibiotics
hvo01230  Biosynthesis of amino acids
Module
hvo_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:hvo00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    HVO_0788 (trpB)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    HVO_0788 (trpB)
Enzymes [BR:hvo01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     HVO_0788 (trpB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP
Motif
Other DBs
NCBI-ProteinID: ADE02680
UniProt: P18285
Position
707461..708729
Genome map
AA seq 422 aa AA seqDB search
MSADGKFGDYGGQYVPEALMPAIEELTDAYERYVLDNEDGFMDDFRARLRDFGGRPTPLQ
RADRLSERYDREVYLKREDLLHGGAHKLNNALGQVLLAKYMGKERIIAETGAGQHGTATA
MACAHLDMPCEIYMGERDINRQRPNVFRMKLNGSEVNPVTVGRGTLKEAISETMRDWATN
VEDTHYVIGSVVGPHPFPSMVRDFQSVISEEARTQAREKLGRLPDAVVACAGGGSNTMGA
FAEFVDDEETALYAVEAGGSTLEVDEEAGVAPNSASLTTGSEGILHGARTRLLQDRDGQI
MESHSVSSGLDYAGVGPELAHLVDTGRVTAVNVDDDAALTAFHRLSQMEGIIPALESAHA
FGYLESVVGPDAPDAENADDLGEYVVVNVSGRGDKDLESAIEETYERDIDIAPNMDEFTG
GL
NT seq 1269 nt NT seq  +upstreamnt  +downstreamnt
atgagcgcagacggcaaattcggcgactacggcggacagtacgttcccgaggcactcatg
ccggccatcgaggaactgaccgacgcgtacgagcggtacgtcctcgacaacgaagacggc
ttcatggacgacttccgcgcgcgactgcgggacttcggcgggcgaccgacgcccctccag
cgcgcggaccgactctcggagcgctacgaccgcgaggtctacctcaagcgcgaggacctc
ctccacggcggcgcgcacaagctcaacaacgcgctcgggcaggtcttactggcgaagtac
atgggcaaagagcgcatcatcgccgagaccggcgcgggccagcacggcaccgccacggcg
atggcctgcgcgcacctcgatatgccctgcgagatttacatgggcgagcgcgacatcaac
cgccagcgccccaacgtcttccggatgaagctcaacggctccgaggtgaaccccgtcacc
gtcggccgcggcacgctcaaggaggccatctccgagacgatgcgcgactgggcgaccaac
gtcgaggacacccactacgtcatcggctccgtcgtcggcccgcacccgttcccgagcatg
gttcgggacttccagtcggtcatctccgaggaggcccgcacgcaggccagagagaaactc
ggccggctccccgacgccgtcgtcgcctgcgcgggcggcggctcgaacacgatgggcgcg
ttcgccgagttcgtcgacgacgaggagaccgcgctctacgccgtcgaggccggcggctcg
acgctcgaagtggacgaggaagccggcgtcgcgcccaactcggcgtcgctcacgaccggg
tcggagggcattctccacggcgcgcgcacccggctcttgcaggaccgcgacggccagatt
atggagtcgcactcggtgtcgtccggcctcgactacgccggcgtcggccccgaactcgca
cacctcgtggacaccggccgcgtcaccgccgtcaacgtcgacgacgacgcggcgctgacc
gcgttccaccggctctcgcagatggagggcatcatccccgccctggagtcggcccacgcg
ttcggctacctcgaatcggtcgtcggtcccgacgcgcccgacgccgagaacgcggacgac
ctcggcgagtacgtcgtggtcaacgtttccggtcgcggcgacaaagacctcgaatcggcc
atcgaggagacctacgagcgcgacatcgatatcgcgccgaacatggacgagttcacgggg
ggcctgtga

DBGET integrated database retrieval system