KEGG   Haloferax volcanii: HVO_0788Help
Entry
HVO_0788          CDS       T01200                                 

Gene name
trpB
Definition
(GenBank) tryptophan synthase beta subunit
  KO
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
hvo  Haloferax volcanii
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:hvo00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    HVO_0788 (trpB)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    HVO_0788 (trpB)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    HVO_0788 (trpB)
Enzymes [BR:hvo01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     HVO_0788 (trpB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
707461..708729
Genome map
AA seq 422 aa AA seqDB search
MSADGKFGDYGGQYVPEALMPAIEELTDAYERYVLDNEDGFMDDFRARLRDFGGRPTPLQ
RADRLSERYDREVYLKREDLLHGGAHKLNNALGQVLLAKYMGKERIIAETGAGQHGTATA
MACAHLDMPCEIYMGERDINRQRPNVFRMKLNGSEVNPVTVGRGTLKEAISETMRDWATN
VEDTHYVIGSVVGPHPFPSMVRDFQSVISEEARTQAREKLGRLPDAVVACAGGGSNTMGA
FAEFVDDEETALYAVEAGGSTLEVDEEAGVAPNSASLTTGSEGILHGARTRLLQDRDGQI
MESHSVSSGLDYAGVGPELAHLVDTGRVTAVNVDDDAALTAFHRLSQMEGIIPALESAHA
FGYLESVVGPDAPDAENADDLGEYVVVNVSGRGDKDLESAIEETYERDIDIAPNMDEFTG
GL
NT seq 1269 nt NT seq  +upstreamnt  +downstreamnt
atgagcgcagacggcaaattcggcgactacggcggacagtacgttcccgaggcactcatg
ccggccatcgaggaactgaccgacgcgtacgagcggtacgtcctcgacaacgaagacggc
ttcatggacgacttccgcgcgcgactgcgggacttcggcgggcgaccgacgcccctccag
cgcgcggaccgactctcggagcgctacgaccgcgaggtctacctcaagcgcgaggacctc
ctccacggcggcgcgcacaagctcaacaacgcgctcgggcaggtcttactggcgaagtac
atgggcaaagagcgcatcatcgccgagaccggcgcgggccagcacggcaccgccacggcg
atggcctgcgcgcacctcgatatgccctgcgagatttacatgggcgagcgcgacatcaac
cgccagcgccccaacgtcttccggatgaagctcaacggctccgaggtgaaccccgtcacc
gtcggccgcggcacgctcaaggaggccatctccgagacgatgcgcgactgggcgaccaac
gtcgaggacacccactacgtcatcggctccgtcgtcggcccgcacccgttcccgagcatg
gttcgggacttccagtcggtcatctccgaggaggcccgcacgcaggccagagagaaactc
ggccggctccccgacgccgtcgtcgcctgcgcgggcggcggctcgaacacgatgggcgcg
ttcgccgagttcgtcgacgacgaggagaccgcgctctacgccgtcgaggccggcggctcg
acgctcgaagtggacgaggaagccggcgtcgcgcccaactcggcgtcgctcacgaccggg
tcggagggcattctccacggcgcgcgcacccggctcttgcaggaccgcgacggccagatt
atggagtcgcactcggtgtcgtccggcctcgactacgccggcgtcggccccgaactcgca
cacctcgtggacaccggccgcgtcaccgccgtcaacgtcgacgacgacgcggcgctgacc
gcgttccaccggctctcgcagatggagggcatcatccccgccctggagtcggcccacgcg
ttcggctacctcgaatcggtcgtcggtcccgacgcgcccgacgccgagaacgcggacgac
ctcggcgagtacgtcgtggtcaacgtttccggtcgcggcgacaaagacctcgaatcggcc
atcgaggagacctacgagcgcgacatcgatatcgcgccgaacatggacgagttcacgggg
ggcctgtga

DBGET integrated database retrieval system