KEGG   Haloferax volcanii: HVO_0788Help
Entry
HVO_0788          CDS       T01200                                 

Gene name
trpB
Definition
tryptophan synthase subunit beta (EC:4.2.1.20)
Orthology
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
hvo  Haloferax volcanii
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:hvo00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    HVO_0788 (trpB)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    HVO_0788 (trpB)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    HVO_0788 (trpB)
Enzymes [BR:hvo01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     HVO_0788 (trpB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
707461..708729
Genome map
AA seq 422 aa AA seqDB search
MSADGKFGDYGGQYVPEALMPAIEELTDAYERYVLDNEDGFMDDFRARLRDFGGRPTPLQ
RADRLSERYDREVYLKREDLLHGGAHKLNNALGQVLLAKYMGKERIIAETGAGQHGTATA
MACAHLDMPCEIYMGERDINRQRPNVFRMKLNGSEVNPVTVGRGTLKEAISETMRDWATN
VEDTHYVIGSVVGPHPFPSMVRDFQSVISEEARTQAREKLGRLPDAVVACAGGGSNTMGA
FAEFVDDEETALYAVEAGGSTLEVDEEAGVAPNSASLTTGSEGILHGARTRLLQDRDGQI
MESHSVSSGLDYAGVGPELAHLVDTGRVTAVNVDDDAALTAFHRLSQMEGIIPALESAHA
FGYLESVVGPDAPDAENADDLGEYVVVNVSGRGDKDLESAIEETYERDIDIAPNMDEFTG
GL
NT seq 1269 nt NT seq  +upstreamnt  +downstreamnt
atgagcgcagacggcaaattcggcgactacggcggacagtacgttcccgaggcactcatg
ccggccatcgaggaactgaccgacgcgtacgagcggtacgtcctcgacaacgaagacggc
ttcatggacgacttccgcgcgcgactgcgggacttcggcgggcgaccgacgcccctccag
cgcgcggaccgactctcggagcgctacgaccgcgaggtctacctcaagcgcgaggacctc
ctccacggcggcgcgcacaagctcaacaacgcgctcgggcaggtcttactggcgaagtac
atgggcaaagagcgcatcatcgccgagaccggcgcgggccagcacggcaccgccacggcg
atggcctgcgcgcacctcgatatgccctgcgagatttacatgggcgagcgcgacatcaac
cgccagcgccccaacgtcttccggatgaagctcaacggctccgaggtgaaccccgtcacc
gtcggccgcggcacgctcaaggaggccatctccgagacgatgcgcgactgggcgaccaac
gtcgaggacacccactacgtcatcggctccgtcgtcggcccgcacccgttcccgagcatg
gttcgggacttccagtcggtcatctccgaggaggcccgcacgcaggccagagagaaactc
ggccggctccccgacgccgtcgtcgcctgcgcgggcggcggctcgaacacgatgggcgcg
ttcgccgagttcgtcgacgacgaggagaccgcgctctacgccgtcgaggccggcggctcg
acgctcgaagtggacgaggaagccggcgtcgcgcccaactcggcgtcgctcacgaccggg
tcggagggcattctccacggcgcgcgcacccggctcttgcaggaccgcgacggccagatt
atggagtcgcactcggtgtcgtccggcctcgactacgccggcgtcggccccgaactcgca
cacctcgtggacaccggccgcgtcaccgccgtcaacgtcgacgacgacgcggcgctgacc
gcgttccaccggctctcgcagatggagggcatcatccccgccctggagtcggcccacgcg
ttcggctacctcgaatcggtcgtcggtcccgacgcgcccgacgccgagaacgcggacgac
ctcggcgagtacgtcgtggtcaacgtttccggtcgcggcgacaaagacctcgaatcggcc
atcgaggagacctacgagcgcgacatcgatatcgcgccgaacatggacgagttcacgggg
ggcctgtga

DBGET integrated database retrieval system