KEGG   Haloferax volcanii: HVO_0789Help
Entry
HVO_0789          CDS       T01200                                 

Gene name
trpA
Definition
(GenBank) tryptophan synthase alpha subunit
  KO
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
hvo  Haloferax volcanii
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:hvo00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    HVO_0789 (trpA)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    HVO_0789 (trpA)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    HVO_0789 (trpA)
Enzymes [BR:hvo01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     HVO_0789 (trpA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
708729..709562
Genome map
AA seq 277 aa AA seqDB search
MSLEDAFSDGPAFVPYLAAGDPDYESSLEYVEALERGGADVIELGLPFSEPIAEGPTIQN
AVVRSLEGGMTPTRFFEFVEDLDVSVPLVCMTYYNLIYRYGDEPGPRPFVEKAAEVGIEG
FVVPDLPAEEAGPLREACDEFGLDLVFIVAPTTRGERLDRIMEQVSGYVYVQARLGTTGA
QSSVSDQTDSSLERLTDYDVPKAVGFGISDGDHAERIVASGADGIIVGSALVDIVAEGHE
NGDDAETVADRLETLARELEDGAVAGASQRPPHPERT
NT seq 834 nt NT seq  +upstreamnt  +downstreamnt
atgtcgctcgaagacgccttctccgacggcccggcgttcgtcccctatcttgccgccggc
gaccccgactacgagtcctcgctcgaatacgtcgaggcgctcgaacgcggcggcgcggac
gtcatcgaactcggacttccgttctcggagcccatcgccgaggggccgaccatccagaac
gcggttgttcggtcgctcgaaggcggcatgacgccgacgcgctttttcgagttcgtcgag
gacctcgacgtgtcggtgccgctggtctgtatgacctactacaacctcatctatcgctac
ggcgatgaacccggaccgcggccgttcgtcgagaaggcggcggaagtcggtatcgagggc
ttcgtcgtccccgacctgccggccgaggaggccggcccgctccgcgaggcctgcgacgag
ttcggcctcgacctcgtgttcatcgtcgcgccgacgacccgcggcgagcgcctcgaccga
atcatggaacaggtctcgggctacgtctacgtgcaggcgcgcctcggcacgacgggcgcg
cagtcgagcgtctccgaccagaccgactcgtcgctcgaacgactcaccgactacgacgtg
cccaaggcggtcggcttcggaatcagcgacggcgaccacgccgagcgcatcgtcgccagc
ggtgccgacggcatcatcgtcggcagcgcgctcgtcgacatcgtcgccgagggccacgag
aacggcgacgacgccgaaacggtcgcggaccgactcgaaacgctcgcccgcgaactcgaa
gacggtgcggtagcgggcgcgtcgcaacgcccaccgcatccggaacgcacataa

DBGET integrated database retrieval system