KEGG   Haloferax volcanii: HVO_0818Help
Entry
HVO_0818          CDS       T01200                                 

Gene name
thrC2
Definition
(RefSeq) threonine synthase (EC:4.2.3.1)
  KO
K01733  
threonine synthase [EC:4.2.3.1]
Organism
hvo  Haloferax volcanii
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:hvo00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    HVO_0818 (thrC2)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    HVO_0818 (thrC2)
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    HVO_0818 (thrC2)
Enzymes [BR:hvo01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     HVO_0818 (thrC2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
737956..739125
Genome map
AA seq 389 aa AA seqDB search
MQTSDSFSGLVCTETGDEYDAAATGPSDADAPLDPAYDLDAVEWDAETLAARPFDTMWRY
RELLPFAEPVTANEGATPLVAADALAEEAEVGSLLIKDEGRNPTGTFLDRGFSLAVTAAR
EADAEVVAHASPGNGAQSAASYAGLVDARSYGFVPSRTPFPNKAMVNVHGGQMKVVGGRY
PDALSALHEQLKSDWHTLQEFDNPYRHDGAKTIAYEVAERLDWSVPDWVVVPVSTGELAY
GVYKGFSDLVELGLVESMPKLVAAQSVGCSPVATAWEADSDTHEAWNQPDTIVGELEIPD
PTGGSLALRAVRESGGAAVAVSDDDALESAVTAAQSAGVEVGPAGGVALAGAWELADEFD
EDDTVVVVNTESGTKNADILRSHLMGQGV
NT seq 1170 nt NT seq  +upstreamnt  +downstreamnt
atgcagacgtctgacagcttctccgggctggtgtgcacggagaccggcgacgagtacgac
gcggccgcgaccggcccgagcgacgccgacgcgccgctcgaccccgcctacgacctcgac
gcggtcgagtgggacgccgagacgctcgccgcgcgccccttcgacacgatgtggcgctac
cgcgaactgctcccgttcgcggagccggtgacggcaaacgagggcgcgacgcccctcgtc
gcggccgacgcgctcgccgaggaggccgaggtcggttcgctcctcatcaaggacgagggc
cgcaacccgaccggaacgttcctcgaccgcggcttctcgctcgccgtcaccgccgcgcgc
gaggccgacgccgaggtcgtcgcgcacgcctcgcccggcaacggcgcgcagtcggcggcc
tcctacgcgggcctcgtggacgctcgctcctacggcttcgtcccctcgcggacgccgttc
ccgaacaaggccatggtgaacgtccacggcggccagatgaaggtcgtcggcgggcgctac
cccgacgcgctttcggcgctccacgaacagctcaaaagcgactggcacacgctccaggag
ttcgacaacccctaccgccacgacggcgcgaaaaccatcgcctacgaggtcgcagagcgc
ctcgactggtcggtccccgactgggtcgtcgtccccgtctcgaccggcgaactcgcctac
ggcgtctacaagggcttttccgacctcgtcgaactcggattggtcgagtcgatgcccaag
ctcgtcgcggcgcagtcggtcggttgctcgcccgtcgccaccgcgtgggaggccgacagc
gacactcacgaggcgtggaaccagccggacaccatcgtcggtgaactggagattcccgac
cccacgggcgggtcgctcgcgctccgcgccgtccgcgagtccggcggtgcggccgtcgcc
gtcagcgacgacgacgcgctcgaatccgccgttactgccgctcagtccgccggcgtcgag
gtcggcccagcgggcggcgtcgcgctcgccggcgcgtgggaactcgcggacgagttcgac
gaagacgacacggtcgtcgtcgtcaacaccgaatccgggacgaagaacgccgacatcctc
cgcagccacctgatgggacagggcgtctga

DBGET integrated database retrieval system