KEGG   Haloferax volcanii: HVO_0894Help
Entry
HVO_0894          CDS       T01200                                 

Gene name
acs1
Definition
(RefSeq) acyl-CoA synthetase (EC:6.2.1.-)
  KO
K01895  
acetyl-CoA synthetase [EC:6.2.1.1]
Organism
hvo  Haloferax volcanii
Pathway
Glycolysis / Gluconeogenesis
Pyruvate metabolism
Propanoate metabolism
Methane metabolism
Carbon fixation pathways in prokaryotes
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:hvo00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    HVO_0894 (acs1)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    HVO_0894 (acs1)
   00620 Pyruvate metabolism
    HVO_0894 (acs1)
   00640 Propanoate metabolism
    HVO_0894 (acs1)
  Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    HVO_0894 (acs1)
   00680 Methane metabolism
    HVO_0894 (acs1)
Enzymes [BR:hvo01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     HVO_0894 (acs1)
Lipid biosynthesis proteins [BR:hvo01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   HVO_0894 (acs1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
811838..813826
Genome map
AA seq 662 aa AA seqDB search
MADGDTELEARLVEQEEFEPSEEFVAQANVSDPAVYDEFEENWPDCWERAAEMLDWDEKY
DEVLDDSNPPFYEWFTGGKLNVSYNCVDRHVENGDKNRVAIKWEGEHGETRTYTYQDLYR
EVNEFAAALRDLGVEEDDVVTLYMPMIPELPIAMLACARIGAPHSVVFGGFSAEALATRM
NAADSRFLVTCDGYYRRGDPLDHLDKANEGLDGVDHGVDATVVVDRLGDDGFDHDLKGNQ
HDWDDLLDEHAGERIDPVERDAEDMLFLMYTSGTTGQPKGVKHTTGGYLAYAAWTSHAVL
DIEKEDTYWCSADIGWITGHSYIVYGPLALGTTTVMYEGTPDFPNRDRLWDIIEKYAVDI
FYTAPTAIRAFMKWGSRFPEQHDLSSLRLLGTVGEPINPRAWKWYYKHIGNEDCPVVDTW
WQTETGGMMITTLPGIKKMKPGSAGPPLPGIDAQIVDTSGKQVDAGRAGYLTVNKPWPGM
LRTLYKNDERFIQEYWQEYSDTDSDDPDDWVYFPEDGAKIDGDDYITILGRVDDVINVSG
HRLGTMEIESAIVGVEGVAEAAVVGGNHEVKGEAVYAYVITEEGQDEDDEMRGRIIEGVE
DAIGPIARPEMVVFTPELPKTRSGKIMRRLLEEIANGEELGDTTTLRNPEVVESIQRQVE
SE
NT seq 1989 nt NT seq  +upstreamnt  +downstreamnt
atggcagacggtgacaccgaactggaggcacggctggtcgagcaggaggagttcgaaccc
tccgaggagttcgtcgcgcaggcgaacgtctccgacccggccgtctacgacgagttcgag
gagaactggcccgactgctgggagcgggccgccgagatgctcgactgggacgagaagtac
gacgaggtactggacgattcgaacccgccgttctacgagtggttcacgggcggcaagctc
aacgtctcgtacaactgcgtggaccgccacgtcgaaaacggggacaagaaccgcgtcgcc
atcaagtgggagggcgaacacggcgagacgcggacgtacacgtatcaggacctctatcgc
gaggtgaacgagttcgcggccgcgctgcgcgacctcggcgtcgaggaagacgacgtggtc
acgctctacatgccgatgattccggaactgccaatcgccatgctggcctgcgcccgcatc
ggcgcgccgcactcggtcgtcttcggcggcttctccgccgaggcgctggcgacgcggatg
aacgccgcggactcccgcttcctcgtcacctgcgacggctactaccgccgcggcgacccg
ctcgaccacctcgacaaggccaacgagggcctcgacggcgtcgaccacggcgtcgacgcg
accgtcgtcgtcgaccgactgggtgacgacggcttcgaccacgacctgaagggcaaccag
cacgactgggacgacctcctcgacgagcacgccggcgagcgcatcgaccccgtcgaacgc
gacgccgaggacatgctgttcctgatgtacacctcggggacgacgggccagccgaagggg
gtcaaacacaccaccggcggctacctcgcgtacgccgcgtggacctcccacgcggtcctc
gacatcgagaaggaagacacctactggtgttcggccgacatcggctggattacgggccac
tcgtacatcgtctacgggccgctcgcgctcggcacgacgacggtgatgtacgaggggacg
cctgacttccccaaccgcgaccgcctgtgggacatcatcgagaagtacgcggtcgacatc
ttctacaccgcgccgacggcgattcgcgcgttcatgaagtggggcagccggttccccgaa
cagcacgacctgtcgagcctccgcctgctcggcacggtgggcgaacctatcaacccgcgc
gcgtggaagtggtactacaagcacatcggcaacgaggactgcccggtcgtggacacgtgg
tggcagaccgagaccggcgggatgatgataacgacgctcccgggaatcaagaagatgaaa
cccggctccgccgggccgccgctgccgggcatcgacgcccaaatcgtcgacacgagcgga
aaacaggtcgacgccgggcgcgcgggctatctcacggtgaacaagccgtggcccggcatg
ctccggacgctctacaagaacgacgagcgcttcattcaggagtactggcaggagtactcc
gacaccgacagcgacgaccccgacgactgggtctacttccccgaggacggcgcgaaaatc
gacggcgacgactatatcaccatcctcgggcgcgtcgacgacgtcatcaacgtctcgggc
caccgcctcgggacgatggaaatcgagtcggccatcgtcggcgtcgagggcgtcgcggag
gccgcggtcgtcggcggcaaccacgaggtgaaaggcgaggccgtctacgcctacgtcatc
accgaggagggtcaggacgaagacgacgagatgcgggggcgcatcatcgagggcgtcgag
gacgccatcggccccatcgctcgccccgagatggtcgtgttcacgccggaacttccgaag
acgcggtctggcaagattatgcgtcggctcctcgaagagattgcgaacggcgaggaactc
ggtgacacgacgacgcttcggaaccccgaagtcgtcgagtcgattcagcggcaggtcgaa
agcgagtaa

DBGET integrated database retrieval system