KEGG   Haloferax volcanii: HVO_0894Help
Entry
HVO_0894          CDS       T01200                                 

Gene name
acs1
Definition
acyl-CoA synthetase (EC:6.2.1.-)
Orthology
K01895  
acetyl-CoA synthetase [EC:6.2.1.1]
Organism
hvo  Haloferax volcanii
Pathway
Glycolysis / Gluconeogenesis
Pyruvate metabolism
Propanoate metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Class
Metabolism; Overview; Carbon metabolism [PATH:hvo01200]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:hvo00010]
Metabolism; Carbohydrate metabolism; Pyruvate metabolism [PATH:hvo00620]
Metabolism; Carbohydrate metabolism; Propanoate metabolism [PATH:hvo00640]
Metabolism; Energy metabolism; Methane metabolism [PATH:hvo00680]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
811838..813826
Genome map
AA seq 662 aa AA seqDB search
MADGDTELEARLVEQEEFEPSEEFVAQANVSDPAVYDEFEENWPDCWERAAEMLDWDEKY
DEVLDDSNPPFYEWFTGGKLNVSYNCVDRHVENGDKNRVAIKWEGEHGETRTYTYQDLYR
EVNEFAAALRDLGVEEDDVVTLYMPMIPELPIAMLACARIGAPHSVVFGGFSAEALATRM
NAADSRFLVTCDGYYRRGDPLDHLDKANEGLDGVDHGVDATVVVDRLGDDGFDHDLKGNQ
HDWDDLLDEHAGERIDPVERDAEDMLFLMYTSGTTGQPKGVKHTTGGYLAYAAWTSHAVL
DIEKEDTYWCSADIGWITGHSYIVYGPLALGTTTVMYEGTPDFPNRDRLWDIIEKYAVDI
FYTAPTAIRAFMKWGSRFPEQHDLSSLRLLGTVGEPINPRAWKWYYKHIGNEDCPVVDTW
WQTETGGMMITTLPGIKKMKPGSAGPPLPGIDAQIVDTSGKQVDAGRAGYLTVNKPWPGM
LRTLYKNDERFIQEYWQEYSDTDSDDPDDWVYFPEDGAKIDGDDYITILGRVDDVINVSG
HRLGTMEIESAIVGVEGVAEAAVVGGNHEVKGEAVYAYVITEEGQDEDDEMRGRIIEGVE
DAIGPIARPEMVVFTPELPKTRSGKIMRRLLEEIANGEELGDTTTLRNPEVVESIQRQVE
SE
NT seq 1989 nt NT seq  +upstreamnt  +downstreamnt
atggcagacggtgacaccgaactggaggcacggctggtcgagcaggaggagttcgaaccc
tccgaggagttcgtcgcgcaggcgaacgtctccgacccggccgtctacgacgagttcgag
gagaactggcccgactgctgggagcgggccgccgagatgctcgactgggacgagaagtac
gacgaggtactggacgattcgaacccgccgttctacgagtggttcacgggcggcaagctc
aacgtctcgtacaactgcgtggaccgccacgtcgaaaacggggacaagaaccgcgtcgcc
atcaagtgggagggcgaacacggcgagacgcggacgtacacgtatcaggacctctatcgc
gaggtgaacgagttcgcggccgcgctgcgcgacctcggcgtcgaggaagacgacgtggtc
acgctctacatgccgatgattccggaactgccaatcgccatgctggcctgcgcccgcatc
ggcgcgccgcactcggtcgtcttcggcggcttctccgccgaggcgctggcgacgcggatg
aacgccgcggactcccgcttcctcgtcacctgcgacggctactaccgccgcggcgacccg
ctcgaccacctcgacaaggccaacgagggcctcgacggcgtcgaccacggcgtcgacgcg
accgtcgtcgtcgaccgactgggtgacgacggcttcgaccacgacctgaagggcaaccag
cacgactgggacgacctcctcgacgagcacgccggcgagcgcatcgaccccgtcgaacgc
gacgccgaggacatgctgttcctgatgtacacctcggggacgacgggccagccgaagggg
gtcaaacacaccaccggcggctacctcgcgtacgccgcgtggacctcccacgcggtcctc
gacatcgagaaggaagacacctactggtgttcggccgacatcggctggattacgggccac
tcgtacatcgtctacgggccgctcgcgctcggcacgacgacggtgatgtacgaggggacg
cctgacttccccaaccgcgaccgcctgtgggacatcatcgagaagtacgcggtcgacatc
ttctacaccgcgccgacggcgattcgcgcgttcatgaagtggggcagccggttccccgaa
cagcacgacctgtcgagcctccgcctgctcggcacggtgggcgaacctatcaacccgcgc
gcgtggaagtggtactacaagcacatcggcaacgaggactgcccggtcgtggacacgtgg
tggcagaccgagaccggcgggatgatgataacgacgctcccgggaatcaagaagatgaaa
cccggctccgccgggccgccgctgccgggcatcgacgcccaaatcgtcgacacgagcgga
aaacaggtcgacgccgggcgcgcgggctatctcacggtgaacaagccgtggcccggcatg
ctccggacgctctacaagaacgacgagcgcttcattcaggagtactggcaggagtactcc
gacaccgacagcgacgaccccgacgactgggtctacttccccgaggacggcgcgaaaatc
gacggcgacgactatatcaccatcctcgggcgcgtcgacgacgtcatcaacgtctcgggc
caccgcctcgggacgatggaaatcgagtcggccatcgtcggcgtcgagggcgtcgcggag
gccgcggtcgtcggcggcaaccacgaggtgaaaggcgaggccgtctacgcctacgtcatc
accgaggagggtcaggacgaagacgacgagatgcgggggcgcatcatcgagggcgtcgag
gacgccatcggccccatcgctcgccccgagatggtcgtgttcacgccggaacttccgaag
acgcggtctggcaagattatgcgtcggctcctcgaagagattgcgaacggcgaggaactc
ggtgacacgacgacgcttcggaaccccgaagtcgtcgagtcgattcagcggcaggtcgaa
agcgagtaa

DBGET integrated database retrieval system