KEGG   Haloferax volcanii: HVO_0965Help
Entry
HVO_0965          CDS       T01200                                 

Definition
(RefSeq) putative thymidine phosphorylase (EC:2.4.2.4)
  KO
K18931  
AMP phosphorylase [EC:2.4.2.57]
Organism
hvo  Haloferax volcanii
Brite
Enzymes [BR:hvo01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.57  AMP phosphorylase
     HVO_0965
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
871193..872671
Genome map
AA seq 492 aa AA seqDB search
MQLVAEHIDIGTRSPTVLLNESDAAELGVHALERVQLRWGERTAIGIVELTDELVSEGTL
GVTRRLGHIEGDVEVSVAPQPDSVYYIRKKLDDIELEADELSQIVRDVYDERLADVELGA
YVSATYTNGLSMEETMHLTESMADVGETVAWEEPVIADKHSIGGVAGNRVTPILVPIVAA
AGLKIPKTSSRAVTSAAGTADAMEVLCDVAFSVAEIRDIVGKTGGCLVWGGAVNLSPVDD
RIIRAETPLSIDPKGQLIASVLSKKKSAGSTNVVVDIPYGEGANVESLAKARELAKDFNR
VGDHLGMAVECAITNGGAPVGRGVGPVLEAREVLATLAGGGPNDLRVKAIRLADLLFESV
GVDADAAEILDSGQAEETFREILAAQNGDPDVEAADLSPGRHTVAVRADRDGVVTHVNNR
LVNEVARRAGAPRDPGAGLELHRRVGEMAASGETLFTVHAESEDKLADAKALTERVETVR
VRHPDEALVERV
NT seq 1479 nt NT seq  +upstreamnt  +downstreamnt
atgcaactcgtcgccgagcacatcgacatcggcacccggtcgccgacggtcctcctgaac
gagagcgacgcggccgaactcggggtccacgcgctcgaacgcgtccaactccggtggggc
gagcggacggccatcggcatcgttgagctgacggacgagctcgtctccgaagggaccctc
ggcgtgacgcgccgcctcggccacatcgagggcgacgtggaggtgtcggtcgcgccgcag
cccgactcggtgtactacatccgcaagaagctcgacgacatcgagctcgaagccgacgaa
ctgtcccaaatcgtccgcgacgtctacgatgagcgcctcgccgacgtggaactcggagcg
tacgtctccgcgacctacaccaacgggctgtccatggaggagacgatgcacctcacggag
tcgatggcggacgtgggcgagaccgtcgcgtgggaggagccggtcatcgccgacaagcac
tccatcgggggcgtcgcgggcaaccgcgtcacgccgattctcgtccccatcgtcgccgcg
gcggggctgaagattccgaagacttcctcgcgagccgtcacctcggccgcgggcaccgcc
gacgcgatggaagtcctctgcgacgtggcattctccgtcgcggagatacgcgatatcgtc
gggaagaccggcggctgtctcgtctggggcggcgcggtgaacctctcgccggtcgacgac
cgcatcatccgcgccgagacgccgctttctatcgaccccaagggacagctcatcgcctcc
gtcctctcgaaaaagaagagcgccgggtcgacaaacgtcgtcgtcgacatcccttacggc
gagggcgcgaacgtcgagagcctcgcgaaggcgcgcgaactcgcgaaggacttcaaccgc
gtcggcgaccacctcgggatggcggtcgagtgcgccatcacgaacgggggcgcaccggtc
ggccgcggcgtcggccccgtgctcgaagcccgcgaggtcctcgccacgctcgccggcggc
ggcccgaacgacctgcgggtgaaggcgattcgcctcgccgacctgctgttcgagtccgtc
ggcgtcgacgccgacgccgccgagattctggactcggggcaggccgaagagaccttccgc
gagatactcgccgcgcagaacggcgaccccgacgttgaggcggcggacctctcgcccggc
cggcacaccgtcgcggtccgcgccgaccgcgacggcgtggtcacgcacgtcaacaaccgc
ctcgtcaacgaggtcgcccgccgggccggcgcgccgcgagaccccggcgcgggcctcgaa
ctccaccgccgcgtcggcgagatggccgccagcggcgagacgctgttcaccgtccacgcc
gagtccgaggacaaactcgccgacgcgaaggcgctcaccgagcgcgtcgagaccgtccgg
gtgcgacaccccgacgaggcgctggtcgagcgggtgtga

DBGET integrated database retrieval system