KEGG   Haloferax volcanii: HVO_1050Help
Entry
HVO_1050          CDS       T01200                                 

Gene name
asnA
Definition
asparagine synthetase
Orthology
K01953  
asparagine synthase (glutamine-hydrolysing) [EC:6.3.5.4]
Organism
hvo  Haloferax volcanii
Pathway
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:hvo00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    HVO_1050 (asnA)
Enzymes [BR:hvo01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.4  asparagine synthase (glutamine-hydrolysing)
     HVO_1050 (asnA)
Peptidases [BR:hvo01002]
 Cysteine Peptidases
  Family C44
   HVO_1050 (asnA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
957649..958740
Genome map
AA seq 363 aa AA seqDB search
MRGASPDLVRRALAERDPLPGTAGFAGELDGRLVRDVLGRQPLFSERADPAKWSFDHRDL
DDPVAVPAGRARQTAGEAAGDDERVWSLPDPPAATDRDAALDRVRDAVFESVRSVDDDGL
AVAFSGGVDSAVVAAGVPDAPCYVAGFEGSHDVAAAREAAAAMDRDLTVVELTHEALERA
VPEIVAALGRTTPMDVQIVLPLYLLAERVAADGYDRLAVGQGADELFGGYAKVQKAPDDP
RVEADTVRGAAREMILTLPDQLERDLLVLRAAGVDPVAPLLHDRVVSAALPLPEEFLVDG
DRRKVALREAASGVLPESVAEADKKAVQYGTYASRELDRLARQAGFKRRMENHVQQYVES
LVE
NT seq 1092 nt NT seq  +upstreamnt  +downstreamnt
atgcgcggcgcgtctcccgacctcgtccggcgcgccctcgccgagcgcgacccgcttccc
ggaactgcgggcttcgcgggcgaactcgacggccgactcgtccgagacgtgctcggtcgc
cagccgctcttctccgagcgcgccgaccccgcgaagtggtcgttcgaccaccgcgacctc
gacgacccggtcgccgtccccgcgggccgcgcccgccagacggccggtgaagccgccggc
gacgacgaacgcgtctggtcgcttcccgacccgccggccgccaccgaccgcgacgccgcg
ctcgaccgcgtccgcgacgcggtcttcgaatcggtccggtcggtggacgacgacggcctc
gccgtggccttctccggcggcgtcgattcggcggtcgtcgcggccggcgtccccgacgcc
ccctgttacgtcgccggtttcgagggctctcacgacgtggccgccgcccgcgaggccgcc
gccgcgatggaccgcgacctcaccgtggtcgaactcacccacgaggcgctcgaacgcgcc
gtcccggaaatcgtcgccgcgctcggccgaacgaccccgatggacgtgcaaatcgttctg
cccctgtacctgctcgcagagcgagtcgccgcggacggttacgaccgtctcgcggtcgga
cagggcgcggacgaactgttcggcggctacgccaaagtccagaaagcccccgacgacccg
cgcgtcgaggccgacaccgtccgcggggccgcccgcgagatgattctcacgctccccgac
cagctcgaacgcgacctgctcgtgctccgcgccgccggggtcgaccccgtcgcgccgctc
ctccacgaccgggttgtctcggctgcgctcccgctccccgaagagttcctcgtggacggc
gaccggcggaaggtcgcgctcagggaggccgcgagcggcgtgctccccgagtcggtcgcg
gaagcggacaagaaggcggtccagtacggcacctacgcctcgcgcgaactcgaccggctc
gcgcggcaggcggggttcaagcggcggatggagaaccacgtccagcagtacgtcgaatcg
ctcgtggagtag

DBGET integrated database retrieval system