KEGG   Haloferax volcanii: HVO_1236Help
Entry
HVO_1236          CDS       T01200                                 

Gene name
acs3
Definition
(RefSeq) acyl-CoA synthetase (EC:6.2.1.-)
  KO
K01895  
acetyl-CoA synthetase [EC:6.2.1.1]
Organism
hvo  Haloferax volcanii
Pathway
Glycolysis / Gluconeogenesis
Pyruvate metabolism
Propanoate metabolism
Methane metabolism
Carbon fixation pathways in prokaryotes
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:hvo00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    HVO_1236 (acs3)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    HVO_1236 (acs3)
   00620 Pyruvate metabolism
    HVO_1236 (acs3)
   00640 Propanoate metabolism
    HVO_1236 (acs3)
  Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    HVO_1236 (acs3)
   00680 Methane metabolism
    HVO_1236 (acs3)
Enzymes [BR:hvo01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     HVO_1236 (acs3)
Lipid biosynthesis proteins [BR:hvo01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   HVO_1236 (acs3)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1126927..1128534)
Genome map
AA seq 535 aa AA seqDB search
MAVDYAAESESFEWDIPEHYNIPAVIESHADAFGDRVALRFRDADGGREERTYGDLRDDM
NRFANALESMGVGKGDRLIHLLPRDPDVFAVQLAALKRGALLVPSSSMLKPKDIAFRAND
CEATTAVVHESLVGMVDEVRDETPLSNFVVLGGDADGWTSFSDLVADASTEHDGPALRAE
DPMSINYTSGTTGQPKPVRHRHRWMRCFELVNAPYWWGVTADDDLSDELLWATTGTGWAK
WFWSPVGVGLTTGATQFVYRGDFEPDAFLDIMEEEGVTRLCAVPTQYRMFAQRDLGSYDL
RLKEALSAGEPLNREPIEAFREAFGVTPRDGYGQTETVALLTNYPGIDVKPGSMGKPTPG
LGTTIIDENEEEVGVDEIGEIAVPVGCPGIFDGYYEKPNLDEKTFSGDYYRTGDLASRDE
DGYFFFEGRADDIIISAGYRIGPFEVEDALVSHEAVAEAAAVASPHEERGSIVKAFVVLT
DGYEGSDDLVDELQSFMKAQTAPYKYPREIEFVAELPKTSSGKIRRIELRSREQD
NT seq 1608 nt NT seq  +upstreamnt  +downstreamnt
atggcagtcgactacgcggccgagtcggaatcgttcgagtgggacatccccgagcactac
aacatccccgcggttatcgagtcgcacgccgacgccttcggcgaccgcgtcgccctccgg
ttccgcgacgccgacggcggccgcgaggagcggacttacggcgacctccgcgacgacatg
aaccgcttcgccaacgcgctcgaatccatgggcgtcgggaagggcgaccggctcatccac
ctcctcccccgcgaccccgacgtgttcgccgtccaactcgccgcgctcaagcgcggcgcg
ctactcgtgcccagttcgtcgatgctcaagcccaaggacatcgcgttccgcgcgaacgac
tgcgaggcgacgaccgccgtcgtccacgagtcgctcgtcggcatggtcgacgaggtgcgc
gacgagacgccgctttcgaacttcgtcgtcctcggcggcgacgccgacggctggacctcg
ttttcggacctcgtcgccgacgcgtccaccgaacacgacggccccgccctccgggccgaa
gacccgatgtccatcaactacacgtcggggacgaccggccagcccaagccggtccgccac
cgccaccgctggatgcggtgtttcgaactcgtcaacgccccctactggtggggcgtcacg
gccgacgatgacctctccgacgaactgctctgggcgacgaccggcaccggctgggccaag
tggttctggagccccgtcggcgtcggtctgacgaccggcgcgacccagttcgtctaccgc
ggcgacttcgaaccggacgcgttcctcgacatcatggaagaggagggcgtcacccgcctc
tgcgccgtcccgactcagtaccggatgttcgcccagcgcgacctcggctcgtacgacctg
cggctgaaagaggcgctgtcggcgggcgaaccgctcaaccgcgaacccatcgaggcgttc
cgcgaggcgttcggcgtcaccccgcgggacggctacggccagaccgagacggtcgcgctc
ctgacgaactaccccggcatcgacgtgaaacccggcagcatgggcaagccgacgcccggc
ctcggcacgaccatcatcgacgaaaacgaggaggaagtcggcgtcgacgaaatcggtgaa
atcgccgtcccggtcggctgccccggcatcttcgacggctactacgagaagccgaacctc
gacgagaagacgttctccggcgactactaccgcaccggcgacctcgcctcccgcgacgag
gacggctacttcttcttcgagggccgcgccgacgacatcatcatctcggcgggctaccgc
atcggccccttcgaggtcgaagacgcgctcgtctcccacgaggcggtcgcggaggccgcc
gcggtcgccagcccccacgaggaacgcggcagcatcgtcaaggcgttcgtcgtcctcacc
gacggctacgagggctccgacgacctcgtggacgaactccagtcgttcatgaaagcgcag
acggccccgtacaagtacccgcgcgaaatcgagttcgtcgcggagctaccgaagacctcc
tcggggaagattcgccgcatcgaactgcggtcccgagagcaggactga

DBGET integrated database retrieval system