KEGG   Haloferax volcanii: HVO_1300Help
Entry
HVO_1300          CDS       T01200                                 

Gene name
tpiA1
Definition
triosephosphate isomerase (EC:5.3.1.1)
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
hvo  Haloferax volcanii
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:hvo00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    HVO_1300 (tpiA1)
   01230 Biosynthesis of amino acids
    HVO_1300 (tpiA1)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    HVO_1300 (tpiA1)
   00051 Fructose and mannose metabolism
    HVO_1300 (tpiA1)
   00562 Inositol phosphate metabolism
    HVO_1300 (tpiA1)
Enzymes [BR:hvo01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     HVO_1300 (tpiA1)
Exosome [BR:hvo04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   HVO_1300 (tpiA1)
  Exosomal proteins of bladder cancer cells
   HVO_1300 (tpiA1)
  Exosomal proteins of melanoma cells
   HVO_1300 (tpiA1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1183977..1184621
Genome map
AA seq 214 aa AA seqDB search
MFILVNLKAYPCDPIEVATAARDVAEASGVRIAVSPQAADISRVADTGVETWAQHVDPNG
HGSHTGSTLAEAVAEAGAVGTLINHSEKRLKLADIDGSVQAAERAGLETCVCANNPAQIG
AVSALGPDSVAVEPPELIGGDVSVATADPGIVTDAVDAAANVDEDVEVYCGAGISTGDDV
VTAEELGASGILLASGVAKADDPRAALEDLVSGL
NT seq 645 nt NT seq  +upstreamnt  +downstreamnt
gtgttcatcctagtcaacctcaaggcgtacccgtgtgaccccatcgaagtcgccaccgcc
gcgcgcgacgtggccgaggcgtccggcgtccgcatcgccgtctccccgcaggcggccgac
atctcccgcgtcgcagacaccggcgtcgagacgtgggcccagcacgtggacccgaacggc
cacggcagccacaccggcagcaccctcgccgaggccgtcgccgaggccggcgcggtcggc
acgctcatcaaccactccgaaaagcgcctgaagctcgctgacatcgacggctccgtccaa
gccgccgagcgagcgggcctcgaaacctgcgtctgcgccaacaaccccgcccaaatcggt
gcggtctccgcgctcggccccgactcggtcgccgtcgagccgccggaactcatcggcggc
gacgtctccgtcgcgacggccgaccccggcatcgtcaccgacgccgtcgacgccgcggcc
aacgtggacgaggacgtggaggtctactgcggcgctggcatctcgaccggcgacgacgtg
gtgaccgccgaggaactcggcgcgtccggcatcctgctggcctccggcgtcgccaaggcc
gacgacccgcgcgcggcgctcgaagacctcgtctccgggctgtaa

DBGET integrated database retrieval system