KEGG   Haloferax volcanii: HVO_1454Help
Entry
HVO_1454          CDS       T01200                                 

Gene name
pyrB
Definition
(GenBank) aspartate carbamoyltransferase catalytic subunit
  KO
K00609  aspartate carbamoyltransferase catalytic subunit [EC:2.1.3.2]
Organism
hvo  Haloferax volcanii
Pathway
hvo00240  Pyrimidine metabolism
hvo00250  Alanine, aspartate and glutamate metabolism
hvo01100  Metabolic pathways
Module
hvo_M00051  Uridine monophosphate biosynthesis, glutamine (+ PRPP) => UMP
Brite
KEGG Orthology (KO) [BR:hvo00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    HVO_1454 (pyrB)
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    HVO_1454 (pyrB)
Enzymes [BR:hvo01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.3  Carboxy- and carbamoyltransferases
    2.1.3.2  aspartate carbamoyltransferase
     HVO_1454 (pyrB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: OTCace_N OTCace
Motif
Other DBs
NCBI-ProteinID: ADE03224
UniProt: D4GY71
Position
1326226..1327140
Genome map
AA seq 304 aa AA seqDB search
MRQDHLISASHLSREDIEAVLDRAADIDADPAAFRQRHAGKVLGLCFFEPSTRTRMSFDS
AMKRLGGQTVDMGPVESSSVKKGETLADTVRVVEGYADALVLRHPSEGAATMAAEFVDVP
LVNAGDGAGQHPSQTLLDLYTIRENAGLDDLTIGIMGDLKYGRTVHSLAEALTNFDASQH
FISPESLRLPRNVRYDLHASGAQVREHTELDEVLPELDVLYVTRIQRERFPDENEYRKVA
GQYQIDSETLDAAADDLTIMHPLPRVDEISPDIDDTDHATYFEQAHNGIPVRMALLDILL
SQDR
NT seq 915 nt NT seq  +upstreamnt  +downstreamnt
atgcgtcaggaccacctcatctccgcgtcgcacctctcgcgggaggacatcgaggcggtg
ctcgaccgcgcggccgacatcgacgccgacccggccgcgttccggcagcgacacgccgga
aaggttctcgggctctgtttcttcgagccgagcacgcgaactcggatgagcttcgactcc
gcgatgaaacgcctcggcggccagaccgtcgatatgggaccggtcgagtcgtcgtcggtc
aagaagggcgagacgctcgccgacaccgtccgcgtggtcgagggctacgccgacgcgctc
gtgctccgccacccgagcgagggcgcggccacgatggccgccgagttcgtcgacgtgccg
ctcgtcaacgcgggcgacggcgcgggccagcacccgagccagaccctcctcgacctctac
accatccgagagaacgccggcctcgacgacctcaccatcggcatcatgggcgacctgaag
tacggccgaacggtccactcgctggccgaggcgctgacgaacttcgacgccagccagcac
ttcatcagccccgagagcctgcgactcccccgaaacgtccgctacgacctccacgcctcg
ggcgcgcaggtcagagaacacaccgaactcgacgaggtgctccccgaactcgacgtgctc
tacgtgacgcgcatccagcgcgagcgcttccccgacgaaaacgagtaccgcaaggtcgcg
ggacagtaccaaatcgactcggagacgctggacgcggcggcggacgacctcactatcatg
cacccgctcccccgcgtggacgagatttctccggacatcgacgacaccgaccacgcgacg
tacttcgaacaggctcacaacggcatcccggtccggatggcgcttctggacatcctcctc
tcccaagaccgatga

DBGET integrated database retrieval system