KEGG   Haloferax volcanii: HVO_1541Help
Entry
HVO_1541          CDS       T01200                                 

Gene name
glpK
Definition
glycerol kinase (EC:2.7.1.30)
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
hvo  Haloferax volcanii
Pathway
Glycerolipid metabolism
Metabolic pathways
Class
Metabolism; Lipid metabolism; Glycerolipid metabolism [PATH:hvo00561]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1409871..1411403
Genome map
AA seq 510 aa AA seqDB search
MSGETYVGAIDQGTTGTRFMVFDHDGKVVANAYEKHEQIYPEPGWVEHDANEIWDNTKQV
IDAALSSAGLDAEQLEAIGITNQRETTLVWDRETGQPIHNAIVWQDRRTTDRIETLEAEG
KTDDVRAKTGLEPDAYFSATKAEWLLDNSDPIKLQRSRPEDIRDRAADGELAFGTIDTWL
IYNLTGNHITDVTNASRTMLFNIHDMEWDDELLDEFNVPRELLPEVRPSSDDDYYGTTDA
DGFLGAEVPVAGALGDQQAALFGQTCFDAGDAKNTYGTGSFMLMNTGDEAVMSEHGLLTT
VGFQRSGEPVQYALEGSIFITGAAIEWLEDMTLIDNAAESEKLARSVESTDGVYFVPAFT
GLGAPHWDQRARGTIVGMTRGTRREHIVRATLESIAFQTRDVAEAMESDSEIDLSSLRVD
GGAVKNNFLCQLQSNILDTEIVRPQVDETTALGAAYAAGLAVGYWETLDELRENWQVDRE
FAPKDPQNVEHRYGRWKEAVDRSLDWAREE
NT seq 1533 nt NT seq  +upstreamnt  +downstreamnt
atgtcaggagaaacttacgtcggtgccatcgaccaaggtaccacaggcacgcggttcatg
gtgttcgaccacgacggcaaggtggtcgccaacgcctacgagaagcacgaacagatctac
ccagagcccggttgggtcgaacacgacgcaaacgagatttgggacaacacgaagcaggtc
atcgacgcggcgctttcgagcgccgggctcgacgccgagcagttagaagccatcggcatc
acgaaccagcgcgagacgacgctcgtctgggaccgtgagaccggacagccgattcacaac
gccatcgtctggcaggaccgtcggacgaccgaccgcatcgagacgctcgaagcggagggc
aagaccgacgacgtgcgcgcgaagacggggctcgaacccgacgcgtacttctctgcgacg
aaagccgagtggctgctggacaactccgaccccatcaagctccagcgctcccgacccgaa
gatatccgagaccgcgccgccgacggcgaactcgccttcgggaccatcgacacgtggctc
atctacaatctgacggggaaccacatcacggacgtgacgaacgcgtcgcggaccatgctg
ttcaacatccacgacatggagtgggacgacgaactcctcgacgagttcaacgtcccgcgc
gaactcctccccgaggtccgcccgtcgtccgacgacgactactacggcacgaccgacgcc
gacggcttcctcggcgcggaagtccccgtcgccggcgcgctcggtgaccagcaggccgcg
ctgttcggccagacctgtttcgacgccggcgacgcgaagaacacctacggcaccggctcg
ttcatgctgatgaacaccggcgacgaggcggtcatgtccgaacacggcctcctcactacc
gtcggcttccagcgctccggtgagccggtccagtacgccctcgaaggctccatcttcatc
acgggcgcggctatcgagtggctcgaagacatgacgctcatcgacaacgccgccgagtcc
gagaagctcgctcggtcggtcgaatccaccgacggcgtctacttcgtccccgcgttcacg
ggcctcggtgcgccccactgggaccagcgcgcccgcggtaccatcgtcggtatgacccgc
ggcacccgccgcgagcacatcgtccgcgcgacgctcgaatccatcgcgttccagacgcgc
gacgtggccgaggcgatggagtccgacagtgaaatcgacctctccagtctccgcgtcgac
ggcggcgctgtcaagaacaacttcctctgtcagctccagtcgaacatcctcgacacggaa
atcgtccgcccgcaggtcgacgagacgaccgccctcggcgcggcctacgccgccggcctc
gccgtcggctactgggagacgctcgacgaactccgcgagaactggcaggtcgaccgcgag
ttcgccccgaaagacccacagaacgtcgagcaccgctacggccgctggaaagaggccgtc
gaccgctcgctcgactgggcacgggaggaataa

DBGET integrated database retrieval system