KEGG   Haloferax volcanii: HVO_1585Help
Entry
HVO_1585          CDS       T01200                                 

Gene name
acs5
Definition
acyl-CoA synthetase (EC:6.2.1.-)
Orthology
K01895  
acetyl-CoA synthetase [EC:6.2.1.1]
Organism
hvo  Haloferax volcanii
Pathway
Glycolysis / Gluconeogenesis
Pyruvate metabolism
Propanoate metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:hvo00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    HVO_1585 (acs5)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    HVO_1585 (acs5)
   00620 Pyruvate metabolism
    HVO_1585 (acs5)
   00640 Propanoate metabolism
    HVO_1585 (acs5)
  Energy metabolism
   00680 Methane metabolism
    HVO_1585 (acs5)
Enzymes [BR:hvo01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     HVO_1585 (acs5)
Lipid biosynthesis proteins [BR:hvo01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   HVO_1585 (acs5)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1455006..1457012
Genome map
AA seq 668 aa AA seqDB search
MDVPDTDTVVHEPDPAFVEDANVTRFMREHDIEDYDELIERTTTEVPGVGASGVEWFWDE
LVDYLDVDFYEEYDAVRDDSEGPQFSRWYPGGEINVAHNTLDRHAAVGSGNRNRVACIWE
GEGGEVVQRTYHDLYREANRVANVLESYGVETGDTVGLYMPMVPEVISILYGCFKVGAIA
VPIFSGFGVDATATRLADPECSVLFTADGFYRRGSEVRLKPTADEAIEEAGCVENVVVYR
RFGDEGDESDADVPWTEGRDEWWGDTVGAADSEYETKRLPSDAESMLLYSSGTTGKPKGI
VHTHAGVQMQTAKEIHFGFDQKPEDRFFWVSDIGWMMGPWTLIGNHTFAGTIFMYEGAPD
YPNPDRFWEMIERHRITTFGISPTAIRALRKYGDEEVEKHDLSSLRLLGSTGEPWDPESW
QWFYEHVGGGEAPIINISGGTEICGCFLMPMPTQPLKPCSLGGPGLGMDIDIADSSGESI
ADSHERGFLVARDSCPSMTKSLWEGDDRYLDTYWSSWDGLWDHGDWAQKDEDGFWFLHGR
ADDALNVAGRKVGPAEVEGALIEHDAVNQAAAVGVPDDTTGTAVVAYVVLEDGIDESDDL
REELRGVVGDELGKPFRPREILFVDEFPKTQSGKIIRRAIASIYAGEDLGDMSSIENPES
LEKIENAS
NT seq 2007 nt NT seq  +upstreamnt  +downstreamnt
atggacgtacccgacaccgacaccgtggtgcacgaaccggacccggcgttcgtcgaggac
gccaacgtcacccgcttcatgcgggaacacgacatcgaggactacgacgagctcatcgag
cgaacgacgaccgaggtgccgggcgtcggtgcctcgggcgtcgagtggttctgggacgag
ctcgtcgactacctcgacgttgacttctacgaggagtacgacgcggtccgcgacgactcg
gaggggccgcagttctcccgctggtaccccggcggcgagataaacgtcgcccacaacacc
ctcgaccgccacgccgcggtcggttccgggaaccggaaccgcgtcgcctgcatctgggag
ggcgaaggcggcgaggtcgtccagcggacctaccacgacctctaccgcgaggccaaccgc
gtcgccaacgtcctcgaatcgtacggcgtcgagaccggcgataccgtcgggctctacatg
ccgatggtccccgaggtcatctctatcctctacggctgtttcaaggtcggcgcgatagcc
gtccccatcttctccggcttcggcgtcgacgccaccgcgacccgcctcgcagaccccgag
tgctcggtgcttttcaccgccgacggcttctaccgccgcggctccgaggtccgactgaaa
ccgaccgccgacgaggccatcgaggaagcgggctgcgtcgagaacgtcgtcgtctaccgg
cggttcggtgacgagggcgatgagagcgacgccgacgtgccgtggaccgagggccgcgac
gagtggtggggcgacaccgtcggcgcggccgactccgagtacgaaaccaaacgcctgccg
tcggacgccgagtcgatgctgctgtactcctcgggaacgaccggcaagccgaaaggcatc
gtccacacccacgcgggcgtccagatgcagaccgccaaggagattcacttcggcttcgac
cagaagcccgaagaccgcttcttctgggtctccgacatcggctggatgatgggcccgtgg
acgctcatcggtaaccacaccttcgccggcaccatcttcatgtacgagggcgcgccagac
tacccgaacccggaccgcttctgggagatgatagagcgccaccgcatcaccaccttcggc
atctcgccgacggccatccgagccctgcggaagtacggcgacgaggaggtcgagaaacac
gacctgtcgagcctccgcctgctcgggtcgaccggcgagccgtgggaccccgagtcgtgg
cagtggttctacgaacacgtcggcggcggcgaggcacccatcatcaacatctccggcggc
accgaaatctgcggctgtttcctcatgccgatgccgacccaaccgctcaaaccctgctcg
ctcggcggccccggcctcgggatggacatcgacatcgcggactcctcgggcgagtccatc
gccgacagccacgagcggggcttcctcgtcgcccgcgactcctgcccgtcgatgaccaag
agcctctgggagggcgacgaccgctacctcgacacctactggtcgtcgtgggacggcctc
tgggaccacggcgactgggcgcagaaagacgaagacggcttttggttcctccacggccgc
gccgacgacgcgctcaacgtggccggccgcaaggtcggccccgccgaggtcgaaggcgcg
ctcatcgaacacgacgcggtgaaccaggccgccgcggtcggcgtccccgacgacaccacc
gggacggccgtcgtcgcctacgtcgtcctagaagacggtatcgacgagagcgacgacctc
cgcgaggagcttcggggcgtcgtcggcgacgagttgggcaagccgttccgcccacgggaa
atcctgttcgtcgacgagttcccgaagacgcagtcgggcaaaatcatccgccgcgccatc
gcctccatctacgcgggcgaggacctcggtgacatgagcagcatcgagaatcccgagtcg
ctcgaaaagatagaaaacgcatcctga

  All links  
No link information was found.   
DBGET integrated database retrieval system