KEGG   Haloferax volcanii: HVO_1585Help
Entry
HVO_1585          CDS       T01200                                 

Gene name
acs5
Definition
(GenBank) acyl-CoA synthetase
  KO
K01895  acetyl-CoA synthetase [EC:6.2.1.1]
Organism
hvo  Haloferax volcanii
Pathway
hvo00010  Glycolysis / Gluconeogenesis
hvo00620  Pyruvate metabolism
hvo00640  Propanoate metabolism
hvo00680  Methane metabolism
hvo00720  Carbon fixation pathways in prokaryotes
hvo01100  Metabolic pathways
hvo01110  Biosynthesis of secondary metabolites
hvo01120  Microbial metabolism in diverse environments
hvo01130  Biosynthesis of antibiotics
hvo01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:hvo00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    HVO_1585 (acs5)
   00620 Pyruvate metabolism
    HVO_1585 (acs5)
   00640 Propanoate metabolism
    HVO_1585 (acs5)
  Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    HVO_1585 (acs5)
   00680 Methane metabolism
    HVO_1585 (acs5)
Enzymes [BR:hvo01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     HVO_1585 (acs5)
Lipid biosynthesis proteins [BR:hvo01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   HVO_1585 (acs5)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding AMP-binding_C ACAS_N
Motif
Other DBs
NCBI-ProteinID: ADE03428
UniProt: D4GZ14
Position
1455006..1457012
Genome map
AA seq 668 aa AA seqDB search
MDVPDTDTVVHEPDPAFVEDANVTRFMREHDIEDYDELIERTTTEVPGVGASGVEWFWDE
LVDYLDVDFYEEYDAVRDDSEGPQFSRWYPGGEINVAHNTLDRHAAVGSGNRNRVACIWE
GEGGEVVQRTYHDLYREANRVANVLESYGVETGDTVGLYMPMVPEVISILYGCFKVGAIA
VPIFSGFGVDATATRLADPECSVLFTADGFYRRGSEVRLKPTADEAIEEAGCVENVVVYR
RFGDEGDESDADVPWTEGRDEWWGDTVGAADSEYETKRLPSDAESMLLYSSGTTGKPKGI
VHTHAGVQMQTAKEIHFGFDQKPEDRFFWVSDIGWMMGPWTLIGNHTFAGTIFMYEGAPD
YPNPDRFWEMIERHRITTFGISPTAIRALRKYGDEEVEKHDLSSLRLLGSTGEPWDPESW
QWFYEHVGGGEAPIINISGGTEICGCFLMPMPTQPLKPCSLGGPGLGMDIDIADSSGESI
ADSHERGFLVARDSCPSMTKSLWEGDDRYLDTYWSSWDGLWDHGDWAQKDEDGFWFLHGR
ADDALNVAGRKVGPAEVEGALIEHDAVNQAAAVGVPDDTTGTAVVAYVVLEDGIDESDDL
REELRGVVGDELGKPFRPREILFVDEFPKTQSGKIIRRAIASIYAGEDLGDMSSIENPES
LEKIENAS
NT seq 2007 nt NT seq  +upstreamnt  +downstreamnt
atggacgtacccgacaccgacaccgtggtgcacgaaccggacccggcgttcgtcgaggac
gccaacgtcacccgcttcatgcgggaacacgacatcgaggactacgacgagctcatcgag
cgaacgacgaccgaggtgccgggcgtcggtgcctcgggcgtcgagtggttctgggacgag
ctcgtcgactacctcgacgttgacttctacgaggagtacgacgcggtccgcgacgactcg
gaggggccgcagttctcccgctggtaccccggcggcgagataaacgtcgcccacaacacc
ctcgaccgccacgccgcggtcggttccgggaaccggaaccgcgtcgcctgcatctgggag
ggcgaaggcggcgaggtcgtccagcggacctaccacgacctctaccgcgaggccaaccgc
gtcgccaacgtcctcgaatcgtacggcgtcgagaccggcgataccgtcgggctctacatg
ccgatggtccccgaggtcatctctatcctctacggctgtttcaaggtcggcgcgatagcc
gtccccatcttctccggcttcggcgtcgacgccaccgcgacccgcctcgcagaccccgag
tgctcggtgcttttcaccgccgacggcttctaccgccgcggctccgaggtccgactgaaa
ccgaccgccgacgaggccatcgaggaagcgggctgcgtcgagaacgtcgtcgtctaccgg
cggttcggtgacgagggcgatgagagcgacgccgacgtgccgtggaccgagggccgcgac
gagtggtggggcgacaccgtcggcgcggccgactccgagtacgaaaccaaacgcctgccg
tcggacgccgagtcgatgctgctgtactcctcgggaacgaccggcaagccgaaaggcatc
gtccacacccacgcgggcgtccagatgcagaccgccaaggagattcacttcggcttcgac
cagaagcccgaagaccgcttcttctgggtctccgacatcggctggatgatgggcccgtgg
acgctcatcggtaaccacaccttcgccggcaccatcttcatgtacgagggcgcgccagac
tacccgaacccggaccgcttctgggagatgatagagcgccaccgcatcaccaccttcggc
atctcgccgacggccatccgagccctgcggaagtacggcgacgaggaggtcgagaaacac
gacctgtcgagcctccgcctgctcgggtcgaccggcgagccgtgggaccccgagtcgtgg
cagtggttctacgaacacgtcggcggcggcgaggcacccatcatcaacatctccggcggc
accgaaatctgcggctgtttcctcatgccgatgccgacccaaccgctcaaaccctgctcg
ctcggcggccccggcctcgggatggacatcgacatcgcggactcctcgggcgagtccatc
gccgacagccacgagcggggcttcctcgtcgcccgcgactcctgcccgtcgatgaccaag
agcctctgggagggcgacgaccgctacctcgacacctactggtcgtcgtgggacggcctc
tgggaccacggcgactgggcgcagaaagacgaagacggcttttggttcctccacggccgc
gccgacgacgcgctcaacgtggccggccgcaaggtcggccccgccgaggtcgaaggcgcg
ctcatcgaacacgacgcggtgaaccaggccgccgcggtcggcgtccccgacgacaccacc
gggacggccgtcgtcgcctacgtcgtcctagaagacggtatcgacgagagcgacgacctc
cgcgaggagcttcggggcgtcgtcggcgacgagttgggcaagccgttccgcccacgggaa
atcctgttcgtcgacgagttcccgaagacgcagtcgggcaaaatcatccgccgcgccatc
gcctccatctacgcgggcgaggacctcggtgacatgagcagcatcgagaatcccgagtcg
ctcgaaaagatagaaaacgcatcctga

DBGET integrated database retrieval system