KEGG   Haloferax volcanii: HVO_2105Help
Entry
HVO_2105          CDS       T01200                                 

Gene name
tpiA2
Definition
triosephosphate isomerase (EC:5.3.1.1)
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
hvo  Haloferax volcanii
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:hvo00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    HVO_2105 (tpiA2)
   01230 Biosynthesis of amino acids
    HVO_2105 (tpiA2)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    HVO_2105 (tpiA2)
   00051 Fructose and mannose metabolism
    HVO_2105 (tpiA2)
   00562 Inositol phosphate metabolism
    HVO_2105 (tpiA2)
Enzymes [BR:hvo01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     HVO_2105 (tpiA2)
Exosome [BR:hvo04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   HVO_2105 (tpiA2)
  Exosomal proteins of bladder cancer cells
   HVO_2105 (tpiA2)
  Exosomal proteins of melanoma cells
   HVO_2105 (tpiA2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1967896..1968573)
Genome map
AA seq 225 aa AA seqDB search
MNLPYPHFQVNFKVYPDTSGEDALAFARLLETIEAETDARFVLTPQLPDIRLITEHTDLA
VTAPAMDAVEPGRGMGKILPETVADAGADGVVINHAENRDTLSDLVWKTERCRDLDLDSV
VCVDSIEMGRAVAEFDPDSMIYEMPEDISSDRAITQTHPDRVRDFMSMVERENPRTRVLV
GGGISTAEDVRLAFEQGGHATGAASAVSLASEPEPLLRDIATSFP
NT seq 678 nt NT seq  +upstreamnt  +downstreamnt
atgaaccttccgtacccccactttcaggtcaacttcaaggtgtatccggacacgagcggc
gaggacgcgctcgcgttcgcgcggctgctcgaaacgatagaggcggagaccgacgcgcgc
ttcgtgttgacgccgcaactgccggacatccggctgataaccgaacacaccgacctcgcc
gtcaccgcgcccgcgatggacgccgtcgagcccggtcgcgggatggggaaaatcctcccg
gagaccgtcgcagacgcgggggccgacggcgtcgtcatcaaccacgcggagaaccgcgac
acgctgtccgacctcgtgtggaaaaccgagcgctgtcgcgacctggacctcgactcggtc
gtctgcgtcgacagcatcgagatgggtcgcgcggtcgcggagttcgaccccgactcgatg
atatacgagatgcccgaggacatctcgtcggaccgcgcgattacgcagacgcaccccgac
cgcgttcgcgacttcatgtcgatggtcgagagggagaatccgcgcactcgcgtcctcgtc
ggcggcggcatctcgaccgccgaagacgtccgcctcgccttcgaacagggaggtcacgcg
accggtgccgcgtcggccgtgtcgctcgcgtcggagccggagccgctcctccgcgacatc
gccacgagtttcccctga

  All links  
No link information was found.   
DBGET integrated database retrieval system