KEGG   Haloferax volcanii: HVO_2183Help
Entry
HVO_2183          CDS       T01200                                 

Gene name
aor4
Definition
aldehyde ferredoxin oxidoreductase (EC:1.2.7.5)
Orthology
K03738  
aldehyde:ferredoxin oxidoreductase [EC:1.2.7.5]
Organism
hvo  Haloferax volcanii
Pathway
Pentose phosphate pathway
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Class
Metabolism; Overview; Carbon metabolism [PATH:hvo01200]
Metabolism; Carbohydrate metabolism; Pentose phosphate pathway [PATH:hvo00030]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2052655..2054586)
Genome map
AA seq 643 aa AA seqDB search
MTELGGYHDRVARVDLSSGDIAYEGIDDEDAKKYIGARGLGVKYVFDQGPDVDPLGPDNL
LAFMTGPLTGTQTVMSGRIAVVTKSPLTGTVTDSHHGGWSGARLKWSGFDGLLFTGKAER
PSYAVVEDGELTLHDAEHLWGKGVHETIEELEGEVEGSLGKNLSIMAIGPGGENEVKYGC
IVNEDDRASGRGGTGAVMGSKNLKAIVVKSGTRMPKPADADTFKQGYQQAMQLIRESEVT
APNEGGLSLYGTNVLMNAGEELDGLPTKNGKYTSTAAMRDAEGADIDSERVSGENVRENI
LVDEPTCHSCPVACKKEVEVSVMHKGEEMNVRGESYEYESAYALGPNSGHTERDEIAVMI
DRCNDMGVDTIEVGNMMAMAMEMSEQGKLDGLSEQLDWGDTERMIDLITEIANRGGDLAD
ALAEGANGLAERFDAHDNSLAVKGQTIPAYDPRCMKGMGIGYATSNRGACHLRGYTPSAE
ILGIPEKHDPHEWRGKGELVALFQDMHAISDSFDICKFNAFAEGIEEYVLQYNGMTGRDV
TEEELLETGDRIYTLERYYNNLAGFDGADDSLPGRFVEGDGAMPGQGASEGQLCELDEMK
EEYYARRQWVDGIVPDERLDELGIDIGPGTGVSRGDSPAPADD
NT seq 1932 nt NT seq  +upstreamnt  +downstreamnt
atgactgaactcggtggttatcacgacagggtcgctcgggtggatctgtcgtccggcgac
atcgcgtacgagggaatcgacgacgaggacgcaaagaagtacatcggggcccgcggcctc
ggcgtgaagtacgtcttcgaccagggaccggacgtggacccgctcggaccggacaacctc
ctcgcgttcatgaccggcccgctcaccggtacgcagaccgtgatgagcggccgaatcgcg
gtcgtgacgaaatccccgctcacggggaccgtcaccgactcgcaccacggcggctggagc
ggcgcgcggctcaagtggtccggcttcgacggcctcctgttcacgggcaaggccgagcgg
ccgagctacgccgtcgtcgaagacggcgaactgacgctccacgacgccgaacacctctgg
ggaaagggcgtccacgagacaatcgaggagctcgaaggcgaggtcgaagggagcctcggc
aagaacctctcgataatggctatcggccccggcggcgaaaacgaggtcaagtacggctgt
atcgtcaacgaggacgaccgcgcgtccggccgcggcggtacgggggcggtcatgggctcg
aagaacctcaaggcgatcgtcgtgaagtccggcacgcggatgccgaagcccgccgacgcc
gacacgttcaagcagggctaccagcaggcgatgcagctcatccgcgagtccgaggtcacc
gcgcccaacgagggcggcctgtcgctgtacgggacgaacgtcctgatgaacgcgggcgag
gagctcgacggcctcccgacgaaaaacgggaagtacacctcgaccgcggcgatgcgagac
gccgagggcgcggacatcgactccgagcgcgtctccggcgagaacgtccgcgagaacatc
ctcgtcgacgagccgacgtgtcactcctgcccggtcgcctgtaagaaggaagtcgaggtg
tcggtgatgcacaaaggcgaggagatgaacgtccgcggcgagtcctacgagtacgagtcc
gcctacgcgctgggcccgaactccgggcacaccgagcgcgacgaaatcgccgtcatgatc
gaccgctgtaacgacatgggggtcgacaccatcgaggtgggcaacatgatggcgatggcg
atggagatgtccgaacagggcaagctcgacggcctgagcgagcagctcgactggggcgac
accgagcgcatgatagacctcatcaccgagattgcgaaccgcggcggcgacctcgcggac
gcgctcgcggagggcgcaaacggcctcgccgagcgcttcgacgcccacgacaactcgctg
gccgtcaagggccagactatcccggcgtacgacccccgctgcatgaagggcatgggcatc
ggctacgccacctcgaaccgcggcgcgtgtcacctccgcggctacacgccgtccgccgag
attctcggcatcccggagaaacacgacccccacgagtggcgcgggaagggcgaactcgtg
gcgctgttccaggacatgcacgccatctcggactcgttcgacatctgcaagttcaacgcg
ttcgcggagggtatcgaggagtacgtcctgcagtacaacggcatgaccggccgcgacgtg
accgaagaggaactgctcgaaaccggcgaccgcatctacacgttagagcggtactacaac
aacctcgccggcttcgacggcgccgacgactcgctgccgggacgcttcgtcgagggcgac
ggggcgatgccgggacagggcgcgtccgaggggcaactgtgcgaactcgacgagatgaaa
gaagagtactacgctcgtcgccagtgggtcgacggcatcgtccccgacgagcgtctcgac
gaactcggcatcgacatcggccccggcacgggcgtctcccgcggcgactcgcccgcaccc
gccgacgactga

DBGET integrated database retrieval system