KEGG   Haloferax volcanii: HVO_2428Help
Entry
HVO_2428          CDS       T01200                                 

Gene name
adh1
Definition
alcohol dehydrogenase (EC:1.1.1.1)
Orthology
K00001  
alcohol dehydrogenase [EC:1.1.1.1]
Organism
hvo  Haloferax volcanii
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Class
Metabolism; Overview; Degradation of aromatic compounds [PATH:hvo01220]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:hvo00010]
Metabolism; Lipid metabolism; Fatty acid degradation [PATH:hvo00071]
Metabolism; Amino acid metabolism; Tyrosine metabolism [PATH:hvo00350]
Metabolism; Xenobiotics biodegradation and metabolism; Chloroalkane and chloroalkene degradation [PATH:hvo00625]
Metabolism; Xenobiotics biodegradation and metabolism; Naphthalene degradation [PATH:hvo00626]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2296586..2297647
Genome map
AA seq 353 aa AA seqDB search
MRAAVLREHGEPLDVTEVPDPTCDADGVVVEVEACGICRSDWHSWMGHGEWADDAVPSGQ
ILGHEPAGRVVEAGDRVETIREGDRVALPFNLACGSCGYCQTGHGNVCTGDHPHALGFEP
AAQGAFAELVHLPSADYNAIQLPEDVLPTDVAALGCRFMTAYNALDARAGLRAGQWVAVH
GCGGVGLSTIQVANVLGARVVAVDVRESALDAAADLGADAVVDGSAEDPVDAIRGLTDGG
AHVSLDALGVAETCRNSVRSVRPRGSHVQVGLTTEAEKGNVSLPTDWMTRHEVSFLGARG
MPPTNADDLLSLLASDAVDPGSLVTKTVSLDEVPERLAAMTDYDTVGVEVMVP
NT seq 1062 nt NT seq  +upstreamnt  +downstreamnt
atgagagccgcagtcctccgcgaacacggtgaaccgctcgacgtgacggaagtacccgac
ccgacgtgcgacgccgacggcgtcgtcgtcgaagtcgaggcctgcggtatctgccggagc
gactggcactcgtggatggggcacggcgagtgggccgacgacgcggtcccgtccgggcag
attctcggccacgagcccgccggccgcgtcgtcgaggccggcgaccgcgtcgagacgatt
cgggagggcgaccgcgtcgccttacccttcaatctcgcctgcggttcgtgcggctactgc
cagaccggccacggcaacgtctgtacgggcgaccacccccacgccctcggcttcgaaccc
gccgcccagggcgcgttcgcggagttagtacatctcccgtccgccgattacaacgcgatt
cagctccccgaggatgtcttaccgaccgacgtggccgcgctcggctgtcggttcatgacg
gcgtacaacgccctcgacgcccgtgccggcctccgcgcggggcagtgggtcgccgtccac
ggctgcggcggcgtcggcctctcgacgattcaggtggcgaacgtcctcggcgcgcgcgtc
gtcgcggtcgacgtgcgcgagtccgcgctcgacgccgcggccgacctcggcgctgacgcc
gtcgtcgacggctccgcggaggacccggttgacgccatccgcggactgaccgacggcggg
gcgcacgtctcgctcgacgcgctcggcgtcgcggagacctgccggaactcggttcgttcg
gtccggccgcggggctcgcacgtacaggtcgggctgacgaccgaggccgaaaaggggaac
gtgtcgctgccgaccgactggatgacgcgacacgaggtgtcgttcctcggcgcgcgcggg
atgccgccgacgaacgccgacgacctgctctcgctgctcgcgtcggacgctgtcgacccc
gggtcgctcgtgacgaaaaccgtctcgctcgacgaggtgcccgagcgactggccgcgatg
accgactacgacaccgtcggcgtcgaagtgatggttccgtaa

DBGET integrated database retrieval system