KEGG   Haloferax volcanii: HVO_2428Help
Entry
HVO_2428          CDS       T01200                                 

Gene name
adh1
Definition
alcohol dehydrogenase (EC:1.1.1.1)
Orthology
K00001  
alcohol dehydrogenase [EC:1.1.1.1]
Organism
hvo  Haloferax volcanii
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:hvo00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    HVO_2428 (adh1)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    HVO_2428 (adh1)
  Lipid metabolism
   00071 Fatty acid degradation
    HVO_2428 (adh1)
  Amino acid metabolism
   00350 Tyrosine metabolism
    HVO_2428 (adh1)
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    HVO_2428 (adh1)
   00626 Naphthalene degradation
    HVO_2428 (adh1)
Enzymes [BR:hvo01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     HVO_2428 (adh1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2296586..2297647
Genome map
AA seq 353 aa AA seqDB search
MRAAVLREHGEPLDVTEVPDPTCDADGVVVEVEACGICRSDWHSWMGHGEWADDAVPSGQ
ILGHEPAGRVVEAGDRVETIREGDRVALPFNLACGSCGYCQTGHGNVCTGDHPHALGFEP
AAQGAFAELVHLPSADYNAIQLPEDVLPTDVAALGCRFMTAYNALDARAGLRAGQWVAVH
GCGGVGLSTIQVANVLGARVVAVDVRESALDAAADLGADAVVDGSAEDPVDAIRGLTDGG
AHVSLDALGVAETCRNSVRSVRPRGSHVQVGLTTEAEKGNVSLPTDWMTRHEVSFLGARG
MPPTNADDLLSLLASDAVDPGSLVTKTVSLDEVPERLAAMTDYDTVGVEVMVP
NT seq 1062 nt NT seq  +upstreamnt  +downstreamnt
atgagagccgcagtcctccgcgaacacggtgaaccgctcgacgtgacggaagtacccgac
ccgacgtgcgacgccgacggcgtcgtcgtcgaagtcgaggcctgcggtatctgccggagc
gactggcactcgtggatggggcacggcgagtgggccgacgacgcggtcccgtccgggcag
attctcggccacgagcccgccggccgcgtcgtcgaggccggcgaccgcgtcgagacgatt
cgggagggcgaccgcgtcgccttacccttcaatctcgcctgcggttcgtgcggctactgc
cagaccggccacggcaacgtctgtacgggcgaccacccccacgccctcggcttcgaaccc
gccgcccagggcgcgttcgcggagttagtacatctcccgtccgccgattacaacgcgatt
cagctccccgaggatgtcttaccgaccgacgtggccgcgctcggctgtcggttcatgacg
gcgtacaacgccctcgacgcccgtgccggcctccgcgcggggcagtgggtcgccgtccac
ggctgcggcggcgtcggcctctcgacgattcaggtggcgaacgtcctcggcgcgcgcgtc
gtcgcggtcgacgtgcgcgagtccgcgctcgacgccgcggccgacctcggcgctgacgcc
gtcgtcgacggctccgcggaggacccggttgacgccatccgcggactgaccgacggcggg
gcgcacgtctcgctcgacgcgctcggcgtcgcggagacctgccggaactcggttcgttcg
gtccggccgcggggctcgcacgtacaggtcgggctgacgaccgaggccgaaaaggggaac
gtgtcgctgccgaccgactggatgacgcgacacgaggtgtcgttcctcggcgcgcgcggg
atgccgccgacgaacgccgacgacctgctctcgctgctcgcgtcggacgctgtcgacccc
gggtcgctcgtgacgaaaaccgtctcgctcgacgaggtgcccgagcgactggccgcgatg
accgactacgacaccgtcggcgtcgaagtgatggttccgtaa

DBGET integrated database retrieval system