KEGG   Haloferax volcanii: HVO_2428Help
Entry
HVO_2428          CDS       T01200                                 

Gene name
adh1
Definition
(GenBank) oxidoreductase (homolog to zinc-containing alcohol dehydrogenase)
  KO
K00001  alcohol dehydrogenase [EC:1.1.1.1]
Organism
hvo  Haloferax volcanii
Pathway
hvo00010  Glycolysis / Gluconeogenesis
hvo00071  Fatty acid degradation
hvo00350  Tyrosine metabolism
hvo00625  Chloroalkane and chloroalkene degradation
hvo00626  Naphthalene degradation
hvo01100  Metabolic pathways
hvo01110  Biosynthesis of secondary metabolites
hvo01120  Microbial metabolism in diverse environments
hvo01130  Biosynthesis of antibiotics
hvo01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:hvo00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    HVO_2428 (adh1)
  Lipid metabolism
   00071 Fatty acid degradation
    HVO_2428 (adh1)
  Amino acid metabolism
   00350 Tyrosine metabolism
    HVO_2428 (adh1)
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    HVO_2428 (adh1)
   00626 Naphthalene degradation
    HVO_2428 (adh1)
Enzymes [BR:hvo01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     HVO_2428 (adh1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N AlaDh_PNT_C ADH_zinc_N_2 2-Hacid_dh_C ELFV_dehydrog SQS_PSY TrkA_N Methyltransf_25 Urocanase 3HCDH_N
Motif
Other DBs
NCBI-ProteinID: ADE04920
UniProt: D4GSN2
Position
2296586..2297647
Genome map
AA seq 353 aa AA seqDB search
MRAAVLREHGEPLDVTEVPDPTCDADGVVVEVEACGICRSDWHSWMGHGEWADDAVPSGQ
ILGHEPAGRVVEAGDRVETIREGDRVALPFNLACGSCGYCQTGHGNVCTGDHPHALGFEP
AAQGAFAELVHLPSADYNAIQLPEDVLPTDVAALGCRFMTAYNALDARAGLRAGQWVAVH
GCGGVGLSTIQVANVLGARVVAVDVRESALDAAADLGADAVVDGSAEDPVDAIRGLTDGG
AHVSLDALGVAETCRNSVRSVRPRGSHVQVGLTTEAEKGNVSLPTDWMTRHEVSFLGARG
MPPTNADDLLSLLASDAVDPGSLVTKTVSLDEVPERLAAMTDYDTVGVEVMVP
NT seq 1062 nt NT seq  +upstreamnt  +downstreamnt
atgagagccgcagtcctccgcgaacacggtgaaccgctcgacgtgacggaagtacccgac
ccgacgtgcgacgccgacggcgtcgtcgtcgaagtcgaggcctgcggtatctgccggagc
gactggcactcgtggatggggcacggcgagtgggccgacgacgcggtcccgtccgggcag
attctcggccacgagcccgccggccgcgtcgtcgaggccggcgaccgcgtcgagacgatt
cgggagggcgaccgcgtcgccttacccttcaatctcgcctgcggttcgtgcggctactgc
cagaccggccacggcaacgtctgtacgggcgaccacccccacgccctcggcttcgaaccc
gccgcccagggcgcgttcgcggagttagtacatctcccgtccgccgattacaacgcgatt
cagctccccgaggatgtcttaccgaccgacgtggccgcgctcggctgtcggttcatgacg
gcgtacaacgccctcgacgcccgtgccggcctccgcgcggggcagtgggtcgccgtccac
ggctgcggcggcgtcggcctctcgacgattcaggtggcgaacgtcctcggcgcgcgcgtc
gtcgcggtcgacgtgcgcgagtccgcgctcgacgccgcggccgacctcggcgctgacgcc
gtcgtcgacggctccgcggaggacccggttgacgccatccgcggactgaccgacggcggg
gcgcacgtctcgctcgacgcgctcggcgtcgcggagacctgccggaactcggttcgttcg
gtccggccgcggggctcgcacgtacaggtcgggctgacgaccgaggccgaaaaggggaac
gtgtcgctgccgaccgactggatgacgcgacacgaggtgtcgttcctcggcgcgcgcggg
atgccgccgacgaacgccgacgacctgctctcgctgctcgcgtcggacgctgtcgacccc
gggtcgctcgtgacgaaaaccgtctcgctcgacgaggtgcccgagcgactggccgcgatg
accgactacgacaccgtcggcgtcgaagtgatggttccgtaa

DBGET integrated database retrieval system