KEGG   Haloferax volcanii: HVO_2612Help
Entry
HVO_2612          CDS       T01200                                 

Gene name
suk
Definition
sugar kinase
Orthology
K00852  
ribokinase [EC:2.7.1.15]
Organism
hvo  Haloferax volcanii
Pathway
Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:hvo00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    HVO_2612 (suk)
Enzymes [BR:hvo01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     HVO_2612 (suk)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2460405..2461322
Genome map
AA seq 305 aa AA seqDB search
MSRVICAGHVNWDVTLRVDALPEPDGEATVESRVGAGGGSAANVASGLVGLDVPAALLGS
VGDDEHGHAAVAELASKGVDCRHVVSVDGGPTTVKYIVVDAAGEVFVLGSPGVNEAFEAT
DLPTDPLAAADHLHLTSQSPETAATLARRAHEEDTTVSFDPGRRVGDRGYADALREVDFV
FLNDREAATALGEAAVQRGRDAAADPVSDVAEALAQTTLVLKHGPRGAEVRDGDDRHVHP
GYPIDAVDTTGAGDAFASGFIAARLDGATYERALAVANACGALTAAEPGARTQLSWRRLD
DLIEG
NT seq 918 nt NT seq  +upstreamnt  +downstreamnt
atgtcccgtgtcatctgcgccggccacgtcaactgggacgtcaccctccgcgtggacgcc
ctgccggagcccgacggcgaggcgaccgtcgagtcgcgggtcggcgcgggcggcggcagc
gccgccaacgtcgccagcggcctcgtcggcctcgacgtgcccgccgcgctcctggggagc
gtcggcgacgacgaacacggccacgccgccgtcgccgaactcgcctcgaagggcgtcgac
tgccgccacgtcgtcagcgtcgacggcggcccgaccacggtcaagtacatcgtcgtcgac
gccgcgggcgaggtgttcgtcctcggctcgcccggcgtcaacgaggcgttcgaggcgacc
gacctcccgaccgacccgctcgcggccgccgaccacctccacctgacgagccagtcgccc
gagacggccgcgacgctcgccagacgggcccacgaggaggatacgacggtcagcttcgac
cccgggcggcgcgtcggcgaccggggctacgccgacgccctccgcgaggtggacttcgtc
tttctcaacgaccgcgaggccgccaccgcgctcggtgaagcggcggtccagcgcggacga
gacgccgccgcagaccccgtctcagacgtggccgaggcgctcgcgcagacgacgctcgtt
ctcaaacacggcccgcgcggcgcggaggtcagagacggcgacgaccgacacgtccacccg
ggctaccctatcgacgcggttgacacgaccggcgcgggcgacgccttcgcctcgggcttc
atcgcggcccgcctcgacggggcgacctacgagcgggcgctggcggtcgccaacgcctgc
ggcgcgctcaccgcggccgaaccgggcgcgcggacgcaactcagttggcggcggctggac
gacctcatcgagggctga

DBGET integrated database retrieval system