KEGG   Haloferax volcanii: HVO_2810Help
Entry
HVO_2810          CDS       T01200                                 

Gene name
sdhD
Definition
(GenBank) succinate dehydrogenase subunit D
  KO
K00242  succinate dehydrogenase / fumarate reductase, membrane anchor subunit
Organism
hvo  Haloferax volcanii
Pathway
hvo00020  Citrate cycle (TCA cycle)
hvo00190  Oxidative phosphorylation
hvo00650  Butanoate metabolism
hvo00720  Carbon fixation pathways in prokaryotes
hvo01100  Metabolic pathways
hvo01110  Biosynthesis of secondary metabolites
hvo01120  Microbial metabolism in diverse environments
hvo01130  Biosynthesis of antibiotics
hvo01200  Carbon metabolism
Module
hvo_M00009  Citrate cycle (TCA cycle, Krebs cycle)
hvo_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
hvo_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:hvo00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    HVO_2810 (sdhD)
   00650 Butanoate metabolism
    HVO_2810 (sdhD)
  Energy metabolism
   00190 Oxidative phosphorylation
    HVO_2810 (sdhD)
   00720 Carbon fixation pathways in prokaryotes
    HVO_2810 (sdhD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sdh_cyt CCB2_CCB4
Motif
Other DBs
NCBI-ProteinID: ADE02540
UniProt: D4GX41
Position
complement(2640557..2640928)
Genome map
AA seq 123 aa AA seqDB search
MAERYTSFEPGGRRWLWQRLTAAFLVVVLAFHFFLLHFVNHADEVTFALSQARMEQLTYF
SLMILFLVTATFHGVNGVYNALVNQGLSGTRKTAVKAILGLASVLLIVQGVRTALEWAGG
VPI
NT seq 372 nt NT seq  +upstreamnt  +downstreamnt
atggcagaacgatacacgtccttcgagcccggcggccggcggtggctctggcagcggctg
accgccgccttcctcgtcgtggtgctggcgttccacttcttcctgctccacttcgtcaac
cacgccgacgaagtgacgttcgccctctcgcaggcgcgcatggagcagctgacgtacttc
tcgctgatgatcctgttcctcgtcaccgcgacgttccacggggtcaacggcgtctacaac
gccctcgtcaaccagggtctctctggaacccggaagacggcggtcaaggcgattctcggt
ctcgcgagcgtcctgctcatcgtgcagggcgtccgcacggccctcgagtgggccggaggt
gttcccatctaa

DBGET integrated database retrieval system