KEGG   Haloferax volcanii: HVO_2810Help
Entry
HVO_2810          CDS       T01200                                 

Gene name
sdhD
Definition
succinate dehydrogenase subunit D (EC:1.3.99.1)
Orthology
K00242  
succinate dehydrogenase membrane anchor subunit
Organism
hvo  Haloferax volcanii
Pathway
Citrate cycle (TCA cycle)
Oxidative phosphorylation
Butanoate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Succinate dehydrogenase, prokaryotes
Class
Metabolism; Overview; Carbon metabolism [PATH:hvo01200]
Metabolism; Carbohydrate metabolism; Citrate cycle (TCA cycle) [PATH:hvo00020]
Metabolism; Carbohydrate metabolism; Butanoate metabolism [PATH:hvo00650]
Metabolism; Energy metabolism; Oxidative phosphorylation [PATH:hvo00190]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2640557..2640928)
Genome map
AA seq 123 aa AA seqDB search
MAERYTSFEPGGRRWLWQRLTAAFLVVVLAFHFFLLHFVNHADEVTFALSQARMEQLTYF
SLMILFLVTATFHGVNGVYNALVNQGLSGTRKTAVKAILGLASVLLIVQGVRTALEWAGG
VPI
NT seq 372 nt NT seq  +upstreamnt  +downstreamnt
atggcagaacgatacacgtccttcgagcccggcggccggcggtggctctggcagcggctg
accgccgccttcctcgtcgtggtgctggcgttccacttcttcctgctccacttcgtcaac
cacgccgacgaagtgacgttcgccctctcgcaggcgcgcatggagcagctgacgtacttc
tcgctgatgatcctgttcctcgtcaccgcgacgttccacggggtcaacggcgtctacaac
gccctcgtcaaccagggtctctctggaacccggaagacggcggtcaaggcgattctcggt
ctcgcgagcgtcctgctcatcgtgcagggcgtccgcacggccctcgagtgggccggaggt
gttcccatctaa

DBGET integrated database retrieval system