KEGG   Haloferax volcanii: HVO_2888Help
Entry
HVO_2888          CDS       T01200                                 

Gene name
elp3
Definition
HAT (histone acetyltransferase) family protein (EC:2.3.1.48)
Orthology
K07739  
elongator complex protein 3 [EC:2.3.1.48]
Organism
hvo  Haloferax volcanii
Brite
Enzymes [BR:hvo01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     HVO_2888 (elp3)
Transfer RNA biogenesis [BR:hvo03016]
 Eukaryotic Type
  tRNA modification factors
   Elongator complex
    HVO_2888 (elp3)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2726318..2727970)
Genome map
AA seq 550 aa AA seqDB search
MSAETETESEAFERTCEALVERILAGDVDRDDLESAKLDACSEHSSPKVPKNAEILQYAP
EDRREEVKEVVQRKPVRTASGVSPVAIMTSPHMCPHGKCLYCPGGPASEFSSSQSYTGHE
PAAARGVQNDYDPYGQVTLRLEQLRHIGHPVDKVELILMGGTMTARSHDYQEWFVKRALE
AMNDYDLDKEPEPAEDRSFKPDPEDVEFEYIEDVIAENETNDIRNIGTTFETKPDWCDPE
QIDRMLDLGATKVEVGVQTTYERINREMHRGHGVQASIDANRRLRDSAFKVGFHMMPGQP
GMTKEMCLEDFRQLFENSDWRPDYLKIYPTLIVRDTVTYDMWRRDEYEPLNNEEAADIVA
EVMGMIPKYTRLQRVQRDIPADFIDAGVWKSNLRQLAAQRAEERGIVQRDIRAREVGMNE
ADPDPERIELDVMTYEVAGGTEHFISFEDPVEDLLVGFCRLRFPGNPVRRELQDAALVRE
LHVYGSEAGIGADGDWQHKGYGKKLLAHAEELSRDAGYDKISVISGIGVRQYYKQKLGYH
QDGPYVSKRL
NT seq 1653 nt NT seq  +upstreamnt  +downstreamnt
gtgagcgccgagaccgagacggagtccgaggcgttcgagcggacctgcgaggcgctcgtc
gagcgcatcctcgcgggcgacgtcgaccgcgacgacctcgaatccgcaaagctcgacgcc
tgttcggaacactcctcgccgaaggttccgaagaacgccgagattctgcagtacgccccg
gaagaccgccgcgaggaggtcaaggaggtcgtccagcgcaagcccgtccgcaccgcctcc
ggcgtctcgccggtcgccatcatgacctcgccgcacatgtgcccccacgggaagtgcctc
tactgtcccggcggacccgccagcgagttctcctcgtcgcagtcgtacacgggccacgag
cccgcggccgcccgcggcgtccagaacgactacgacccctacgggcaggtcacgctccgc
ctcgaacagcttcgacacatcggccaccccgtggacaaggtcgaactcatcctcatgggc
gggacgatgaccgcccggagccacgactaccaggagtggttcgtcaagcgggcgctcgaa
gccatgaacgactacgacctcgacaaggagccggaaccggccgaagaccggtcgttcaag
cccgaccccgaggatgtcgagttcgagtacatcgaggacgtcatcgcggaaaacgagacg
aacgacatccgcaacatcggaacgacgttcgagacgaagcccgactggtgcgaccccgag
caaatcgaccggatgctcgatttgggcgcgacgaaggtcgaagtcggcgtccagacgacc
tacgagcgcatcaaccgcgagatgcaccgcggccacggcgtgcaggcctccatcgacgcc
aaccgccgcctccgcgactcggcgttcaaggtcggcttccacatgatgcccggtcagccc
ggcatgaccaaggagatgtgtctggaggacttccgtcagctgttcgaaaacagcgactgg
cggcccgactacctcaaaatctacccgacgctcatcgtccgcgacaccgtcacctacgac
atgtggcggcgcgacgagtacgagccgctgaacaacgaggaggccgccgacatcgtcgcg
gaggtcatgggcatgattccgaagtacacacgcctccagcgcgtccagcgggacatcccc
gcggacttcatcgacgccggcgtctggaagtccaacctccgccaactggccgcccagcgc
gccgaggagcgcggcatcgtccagcgggacatccgcgcccgcgaggtcggcatgaacgag
gccgacccggacccagaacgcatcgaactcgacgtgatgacctacgaggtcgccggcggg
accgagcacttcatctcgttcgaagaccccgtcgaggacctgctggtcggcttctgccgg
ctccgattccccggcaatccggtccgccgcgagcttcaggacgcggcgctcgtccgcgaa
ctccacgtctacggctccgaggcgggcatcggtgccgacggcgactggcaacacaagggc
tacgggaagaagctcctcgcccacgccgaggaactgtcccgcgacgccggctacgacaag
atttcggtcatctcgggtatcggcgtccggcagtactacaagcagaagctcggctaccat
caggacgggccgtacgtgtcgaagcggttgtag

DBGET integrated database retrieval system