KEGG   Haloferax volcanii: HVO_2919Help
Entry
HVO_2919          CDS       T01200                                 

Gene name
hdrB
Definition
dihydrofolate reductase (EC:1.5.1.3)
Orthology
K00287  
dihydrofolate reductase [EC:1.5.1.3]
Organism
hvo  Haloferax volcanii
Pathway
One carbon pool by folate
Folate biosynthesis
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:hvo00790]
Metabolism; Metabolism of cofactors and vitamins; One carbon pool by folate [PATH:hvo00670]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2754021..2754605
Genome map
AA seq 194 aa AA seqDB search
MSGEELSGSETEGDAAVRFVLVAAVADNRVIGRDGDMPWHLPEDLKQFKRTTTGHPVVMG
RKTYESIARQLGGPLPERHSVVLTTRDLDLPEGAEAVESVESAVAAAEDAADEMGVETVY
VVGGATVYEQFLGRAAGLVLTELDAAHEGDTRFPEWDRGKWVETDRDDRDGFSFVTYERK
QPAAADRGAEESDE
NT seq 585 nt NT seq  +upstreamnt  +downstreamnt
atgagcggcgaggagctttctgggtccgaaaccgagggcgacgccgcggtccggttcgtc
ctcgtcgccgccgtcgccgacaaccgcgtcatcggccgcgacggcgacatgccgtggcac
ctccccgaggacctgaaacagttcaagcggacgacgaccggccacccggtcgtgatgggt
cgcaagacctacgagagcatcgcccgccaactcggcggcccgcttccggagcgtcacagc
gtcgtgctgacgacccgcgacctcgacctccccgagggcgctgaagcggtcgagtcggtc
gagtcggcggtcgccgccgccgaggacgcggccgacgagatgggcgtcgagaccgtctac
gtcgtcggcggcgcgaccgtctacgagcagttcctcggccgcgccgcggggctggtgctc
accgaactcgacgcggcacacgaaggcgacacgcggttccccgagtgggaccgcgggaag
tgggtcgagaccgaccgcgacgaccgcgacggcttttcgttcgtcacgtacgagcgcaaa
cagcccgccgcggctgaccgcggcgcggaggaatccgatgagtaa

DBGET integrated database retrieval system