KEGG   Haloferax volcanii: HVO_2919Help
Entry
HVO_2919          CDS       T01200                                 

Gene name
hdrB
Definition
dihydrofolate reductase (EC:1.5.1.3)
Orthology
K00287  
dihydrofolate reductase [EC:1.5.1.3]
Organism
hvo  Haloferax volcanii
Pathway
One carbon pool by folate
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:hvo00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    HVO_2919 (hdrB)
   00670 One carbon pool by folate
    HVO_2919 (hdrB)
Enzymes [BR:hvo01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.3  dihydrofolate reductase
     HVO_2919 (hdrB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2754021..2754605
Genome map
AA seq 194 aa AA seqDB search
MSGEELSGSETEGDAAVRFVLVAAVADNRVIGRDGDMPWHLPEDLKQFKRTTTGHPVVMG
RKTYESIARQLGGPLPERHSVVLTTRDLDLPEGAEAVESVESAVAAAEDAADEMGVETVY
VVGGATVYEQFLGRAAGLVLTELDAAHEGDTRFPEWDRGKWVETDRDDRDGFSFVTYERK
QPAAADRGAEESDE
NT seq 585 nt NT seq  +upstreamnt  +downstreamnt
atgagcggcgaggagctttctgggtccgaaaccgagggcgacgccgcggtccggttcgtc
ctcgtcgccgccgtcgccgacaaccgcgtcatcggccgcgacggcgacatgccgtggcac
ctccccgaggacctgaaacagttcaagcggacgacgaccggccacccggtcgtgatgggt
cgcaagacctacgagagcatcgcccgccaactcggcggcccgcttccggagcgtcacagc
gtcgtgctgacgacccgcgacctcgacctccccgagggcgctgaagcggtcgagtcggtc
gagtcggcggtcgccgccgccgaggacgcggccgacgagatgggcgtcgagaccgtctac
gtcgtcggcggcgcgaccgtctacgagcagttcctcggccgcgccgcggggctggtgctc
accgaactcgacgcggcacacgaaggcgacacgcggttccccgagtgggaccgcgggaag
tgggtcgagaccgaccgcgacgaccgcgacggcttttcgttcgtcacgtacgagcgcaaa
cagcccgccgcggctgaccgcggcgcggaggaatccgatgagtaa

DBGET integrated database retrieval system