KEGG   Haloferax volcanii: HVO_2989Help
Entry
HVO_2989          CDS       T01200                                 

Gene name
pmu2
Definition
(GenBank) phosphomannomutase
  KO
K15778  phosphomannomutase / phosphoglucomutase [EC:5.4.2.8 5.4.2.2]
Organism
hvo  Haloferax volcanii
Pathway
hvo00010  Glycolysis / Gluconeogenesis
hvo00030  Pentose phosphate pathway
hvo00051  Fructose and mannose metabolism
hvo00052  Galactose metabolism
hvo00230  Purine metabolism
hvo00500  Starch and sucrose metabolism
hvo00520  Amino sugar and nucleotide sugar metabolism
hvo00521  Streptomycin biosynthesis
hvo01100  Metabolic pathways
hvo01110  Biosynthesis of secondary metabolites
hvo01120  Microbial metabolism in diverse environments
hvo01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:hvo00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    HVO_2989 (pmu2)
   00030 Pentose phosphate pathway
    HVO_2989 (pmu2)
   00051 Fructose and mannose metabolism
    HVO_2989 (pmu2)
   00052 Galactose metabolism
    HVO_2989 (pmu2)
   00500 Starch and sucrose metabolism
    HVO_2989 (pmu2)
   00520 Amino sugar and nucleotide sugar metabolism
    HVO_2989 (pmu2)
  Nucleotide metabolism
   00230 Purine metabolism
    HVO_2989 (pmu2)
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    HVO_2989 (pmu2)
Enzymes [BR:hvo01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.2  phosphoglucomutase (alpha-D-glucose-1,6-bisphosphate-dependent)
     HVO_2989 (pmu2)
    5.4.2.8  phosphomannomutase
     HVO_2989 (pmu2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PGM_PMM_I PGM_PMM_II PGM_PMM_IV PGM_PMM_III DUF4440
Motif
Other DBs
NCBI-ProteinID: ADE04884
UniProt: D4GY77
Position
2819632..2820996
Genome map
AA seq 454 aa AA seqDB search
MKLFGSSGTRGVVGESLTPEFVLRVAKAAGTVWNTGRVAIARDTRTTGEMFVNAAESGLA
SVGVDVDDLGVVPTPAAVRYCENQAVPGVVITASHNPPEFNGVKLVGDDGVELAVEELER
IEDHILAEEFDVTEWDAVGSVRSVETANDDYHEDLLANVDREKIAAANLTVALDPGHGAG
SLVTPDFLRELGCEVRTVNAQPDGHFPGRQSEPVPENLRDLERLVRATDADVGIAHDGDA
DRAVFVNERGECISGEASLAALAAAALEPGDATVSAVNVSQRLVDVCEEVGADLELTPIG
ATNLITRIRELWREGRNVPVAGEGNGGVFYPNYRLVRDGAYIAAKFLELVAERSASELVA
PYEDYYNVRINLEYDEEAELTAMLNAAADYAESADATPNTTDGYRLDYGDAWVLVRPSGT
EPKVRVYAEGRSEERATELAEDAADALRSAVATL
NT seq 1365 nt NT seq  +upstreamnt  +downstreamnt
atgaaactcttcggttccagcggcacccgcggcgtggtgggtgagagcctcaccccggag
ttcgtcctccgcgtcgccaaggccgccggcacggtctggaacaccggccgggtcgccatc
gcacgggacacccgaaccacgggcgagatgttcgtcaacgccgccgagtccgggctggcg
agcgtcggcgtcgacgtggacgacctcggcgtcgtccccacccccgcggcggtccgctac
tgcgagaatcaggccgttccgggcgtcgtcatcacggcctcgcacaaccccccggagttc
aacggcgtcaaactcgtcggcgacgacggcgtcgaactcgccgtcgaggagctagagcgc
atcgaagaccacatcctcgccgaggagttcgacgtgaccgagtgggacgccgtcgggagc
gtccggtcggtcgagaccgcgaacgacgactaccacgaggacctcctcgccaacgtcgac
cgcgagaaaatcgctgccgcgaacctcacggtcgcgctcgaccccggccacggcgccggg
tcgctcgtcacgcccgacttcctccgcgaactcggctgcgaggtccgcacggtcaacgcc
cagcccgacggccacttccccggtcgccagtccgagccggtccccgagaacctccgcgac
ctcgaacgcctcgtccgcgcgaccgacgccgacgtgggaatcgcccacgacggcgacgcc
gaccgggccgtcttcgtgaacgagcgcggcgagtgcatctccggcgaggcgtcgctggcc
gccctcgcggccgccgccctcgaaccgggcgacgcgaccgtctccgccgtgaacgtctcc
cagcgcctcgtcgacgtctgcgaggaggtcggtgccgacctcgaactcacgcccatcggc
gcgacgaacctcatcacccgcatccgcgagctctggcgcgagggtcggaacgtccccgtc
gcgggcgaggggaacggaggagtgttctaccccaactaccgcctcgtccgcgacggcgcg
tacatcgcggcgaagttcctcgaactcgtcgccgagcgctccgcgagcgaactcgtcgcg
ccctacgaggactactacaacgtccgcatcaacctcgaatacgacgaggaagccgagttg
acggcgatgctcaacgccgccgccgactacgccgaatcggccgacgcgaccccgaacacg
accgacggctaccgcctcgactacggcgacgcgtgggtgctcgtccgcccctccgggacc
gagccgaaagtccgcgtctacgccgaaggccgctccgaggagcgcgcgaccgaactcgcc
gaagacgccgccgacgcgctccgaagcgcggtcgcgacgctgtaa

DBGET integrated database retrieval system