KEGG   Haloferax volcanii: HVO_A0200Help
Entry
HVO_A0200         CDS       T01200                                 

Definition
asparagine synthase
Orthology
K01953  
asparagine synthase (glutamine-hydrolysing) [EC:6.3.5.4]
Organism
hvo  Haloferax volcanii
Pathway
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Amino acid metabolism; Alanine, aspartate and glutamate metabolism [PATH:hvo00250]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
pHV4:202975..204816
Genome map
AA seq 613 aa AA seqDB search
MTGFVGGALDAATLDACAAELHHEDWYESAARSTGRFGVSVLHHGARDPEGCTVWEDGPR
VGAIYGAVTNLDELELDVDGLFARLFEDPHALLPELDGSFLVVAVDGDAERVVLASDKLG
TRQCFYVAGEPFAFGTEVGALTTLLDDPQVDERAISDLLMIGHVWGDKTLVQGVKFLPSG
TVLDYRADAGPELDSYWHHTFEQSPDDSYLDDLTEAYREVIADMADTIDGDIGLWLSGGL
DSRSMAGELSRYHDLTTYTYDSNPANGSNLELAAKVSAVLGLENRRVPVESDALVDSLDK
SVQLTSGMVGLSTFVNLANVFNIEDMPDVLIEGCGQGGMMGDGIGRAAVEGSKSPEAALY
RAKHRIDVDDARRLLRTEFDPMTTYREEVRKSDQPDLFSTAMDCYYRNYFPRCDFASNPI
AESQAGTRVPFSDTGFLRAVTRMPLSHRVGSIPLTNGKIPAGTAYPKVELVRRLDSRLAA
IPYERTKVPPARPMWQHAAGFVVGTSVDRIRERLVGDVHTYGGRSTIGDWYRTNRALRER
IDDLLDSACERPYFDADEIRRLQREERTGEAEHMSAISGIITGELWVRKYIDREGERGTA
SVAEAEDAPQPAD
NT seq 1842 nt NT seq  +upstreamnt  +downstreamnt
atgactggcttcgtcggcggcgcgctcgacgcggcgacgctcgacgcctgcgcggccgaa
ctccaccacgaagactggtacgagtcggcggcgcggtcgaccggccgcttcggcgtctcg
gtgctccaccacggcgcgagagaccccgagggctgtaccgtctgggaagacggcccgcgc
gtgggagcgatatacggcgcggtgacgaacctcgacgaactcgaactcgacgtagacggg
ctgttcgcccgactgttcgaggacccacacgccctgctgcccgaactcgacggctcgttc
ctcgtcgtcgccgtcgacggcgacgcggagcgcgtcgtgctcgccagcgacaaactcggg
acgcgacagtgtttctacgtcgcgggcgagccgttcgccttcgggaccgaagtcggcgcg
ctgacgaccctcctcgacgacccgcaggtcgacgaacgcgccatcagcgacctcctcatg
attgggcacgtctggggcgacaagacgctcgtgcagggcgtgaagttcctcccctcgggg
accgtcctcgactaccgggccgacgcggggcccgagctcgactcctactggcaccacacg
ttcgaacagagccccgacgactcctacctcgacgacctcaccgaggcctaccgcgaggtc
atcgccgacatggccgacacgatagacggcgatatcggcctgtggctctccggcggcctc
gacagtcgctcgatggccggggagctcagccgctaccacgacctcacgacctacacctac
gactcgaaccccgcgaacgggagcaatctcgaactcgccgcgaaggtttctgcggtgctc
ggcctcgaaaaccggcgcgtgccggtcgagtccgacgccctcgtcgactcgctcgacaaa
tcggtccaactgaccagcgggatggtcggtctctccacgttcgtcaacctcgcgaacgtg
ttcaacatcgaggacatgcccgacgtgctcatcgagggctgcggacagggcgggatgatg
ggtgacggcatcggccgggccgccgtcgaggggagcaagtcacccgaggcggcgctctac
cgcgcgaaacaccgcatcgacgtggacgacgcccgccggctcctacggacggagttcgac
ccgatgacgacctaccgcgaggaggttcgcaagagcgaccagccggacctcttcagcacc
gcgatggactgctactaccgcaactacttcccgcggtgcgacttcgccagcaaccccatc
gccgagagccaggccggcacccgggtcccgttcagcgacaccgggtttctccgggccgtg
acgcggatgccgctgtcgcaccgcgtcggctcgattccactcaccaacgggaagattccc
gccggaacggcctacccgaaggtcgaactggtccgccgcctcgacagccgactcgcggcc
atcccctacgaacggacgaaagtgccgccggcgcgcccgatgtggcaacacgccgccggc
ttcgtcgtcggcacctccgtcgaccgcatccgcgagcgcctcgtcggcgacgtccacacc
tacggcggccgctccactatcggcgactggtaccggacgaaccgcgcgctccgcgagcgc
atcgacgacctgctcgactccgcgtgcgaacgcccgtacttcgacgccgacgagattcgc
cgcctccagcgcgaggagcgcacgggcgaagccgaacacatgagcgccatctccggcatc
atcaccggcgagctctgggtccgcaaatacatcgaccgcgaaggcgaacgcggaaccgcg
agtgtggcggaagccgaagacgcaccacaaccggccgactga

DBGET integrated database retrieval system