KEGG   Haloferax volcanii: HVO_A0268Help
Entry
HVO_A0268         CDS       T01200                                 

Gene name
fuca
Definition
L-fuculose phosphate aldolase
Orthology
K01628  
L-fuculose-phosphate aldolase [EC:4.1.2.17]
Organism
hvo  Haloferax volcanii
Pathway
Fructose and mannose metabolism
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:hvo00001]
 Metabolism
  Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    HVO_A0268 (fuca)
Enzymes [BR:hvo01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.17  L-fuculose-phosphate aldolase
     HVO_A0268 (fuca)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
pHV4:272548..273888
Genome map
AA seq 446 aa AA seqDB search
MTVNEPQRLVSTLGKRMLADGLTKGTGGNISVRADDGTVAISPSGMPYEEIEPEDVPILD
INGERVAGDRKPSSEFRMHTDVLRQREDVGAVVHNHSPYASTFASIDEPVGPSHYLIAFI
GDEIPVASYETYGTAELADVAVETLGDDYNACLLEKHGVLATGATAEEAYEVALMVEYCA
RIHYQARSVGEPSLLPDEEIDTLLDRFADYGQTQSADEDGPDPTGDRVPADRLSDLASHR
SAVSEFGREMLHQGLTEGTGGNISAQADDLVAISPSGMPYDEIESEDVPVVTLDGELVAG
DRKPSSEVRMHTGILREREDAGAVVHNHSPYASTFASLGEPIPASHYLIAFAGDEIPVAG
YETYGTQGLADLALEALGDDYNACLLENHGVVAVGDSVAEAYEVALMVEYCARIHYQALN
IGEPSLLPDEEIDTLLDRFADYGQDH
NT seq 1341 nt NT seq  +upstreamnt  +downstreamnt
atgacggtgaacgagcctcagcgtctagtcagtacgctcggcaagcgcatgctggcagac
ggcctcacgaaaggaaccggcggaaacatcagcgtcagggcggacgacggaactgtcgcc
atcagcccctcggggatgccctacgaagaaatcgaacccgaggacgtaccgatactcgac
atcaacggagaacgagtcgccggcgaccgcaagccatcgagcgagttccggatgcacacg
gacgtgctccgccagcgcgaggacgtgggcgcggtggtccacaaccactccccgtacgcc
agcactttcgccagtatcgacgaaccagtcggcccctcgcactacctcatcgcgttcatc
ggcgacgagattcccgtggcgagttacgaaacctacgggaccgctgaactcgccgacgtg
gcggtggagacgttaggcgacgactacaacgcctgtctcctcgaaaaacacggcgtcctc
gctaccggtgcgaccgccgaggaggcgtacgaggtggcgctcatggtcgagtactgtgcc
cgcatccactaccaggcgcgcagcgtcggcgagccctcgctgctccccgacgaggaaatc
gacactctcctcgaccgcttcgccgactacgggcagacgcagtcggccgacgaggacggg
ccggacccgaccggggatcgcgtccccgccgaccgactatccgacctcgcgtcgcaccgc
tcggcggtcagcgagttcggccgtgagatgctccatcagggactgaccgaggggaccggc
ggaaacatcagcgcgcaggccgacgacctcgtcgccatcagtccctcggggatgccctac
gacgagatcgaatccgaggacgtgcccgtcgtcacgctggacggcgagttggtcgccggc
gaccgcaagccgtcgagcgaggtccgtatgcataccggcatcctccgcgagcgcgaggac
gcgggcgcggtagtccacaatcactccccgtacgccagcaccttcgcgagcctcggcgag
ccgattccggcctcgcactacctcatcgcctttgccggcgacgagattcccgtcgcgggg
tacgagacttacgggacgcagggactggccgacctcgctctggaggcactgggcgacgac
tacaacgcctgtctcctcgaaaaccacggcgtcgtcgccgtcggcgactccgtcgcggag
gcgtacgaggtggcgctcatggtcgagtactgcgcccgcatccactaccaggcgctcaac
atcggcgagccctcgctactccccgacgaggaaatcgataccctcctcgaccgcttcgcc
gactacggacaggaccactaa

DBGET integrated database retrieval system