KEGG   Haloferax volcanii: HVO_A0326Help
Entry
HVO_A0326         CDS       T01200                                 

Gene name
bgaH
Definition
(GenBank) beta-D-galactosidase
  KO
K12308  beta-galactosidase [EC:3.2.1.23]
Organism
hvo  Haloferax volcanii
Pathway
hvo00052  Galactose metabolism
Brite
KEGG Orthology (KO) [BR:hvo00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    HVO_A0326 (bgaH)
Enzymes [BR:hvo01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.23  beta-galactosidase
     HVO_A0326 (bgaH)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_42 Glyco_hydro_42M Glyco_hydro_42C Cellulase Glyco_hydro_14 Glyco_transf_4 DUF4434
Motif
Other DBs
NCBI-ProteinID: ADE01962
UniProt: D4GR03
Position
pHV4:complement(336439..338493)
Genome map
AA seq 684 aa AA seqDB search
MTVGVCYFPEHWSRERWETDISQMAEAGIEYVRMGEFAWRRIEPERGTFDFAWLDETVEL
IGKSGMKAVLCTPTATPPKWLVDEHPDVRQREQDGTPREWGSRRFTCFNSPTYRSETERI
VSVLTDRYADNPHVAGWQTDNEFGCHETVTCYCEDCGEAFSEWLADRYESVADLNDAWGT
TFWSQQYDDFESIDPPKPTPAANHPSRVLAYERFSNDSVAEYNRLHAALIREANDEWFVT
HNFMGGFSLDAFRLADDLDFLSWDSYPTGFVQDRQPDTPTVDELRAGNPDQVSMNHDLQR
GAKGKPFWVMEQQPGDINWPPQSPQPADGAMRLWAHHAVAHGADAVVYFRWRRCRQGQEQ
YHAGLRRQDGSPDRGYREASTAADELFDLDSVDASVALVHDYESLWATRSQPLSPDWDYW
NHLRTYYDALRADVEPPSGVTSSLRTYYDALRARGVQVDIVSPEATLERYDAVVAPTLYL
VGDELSTALTDYVDSGGCLLLGARTGEKDPYNRLHESLAPGPLTALTGAQVARHETLPDH
VETRLSYDGATYEFRTWASWLAPEVGVPRGEYRTGEAAGNTAIVRNAAGDGSVTYCGCWP
GDDLADALVTELLDAAGVEYTERFPDGVRVMERDGYTWALNFTSDPVTLTVPDSTGFLLG
ESTVDAFDTAVLDGSIRGVGLASE
NT seq 2055 nt NT seq  +upstreamnt  +downstreamnt
atgacagttggtgtctgctatttcccggagcactggtcgcgagagcgctgggagaccgat
atcagtcagatggccgaggctggaatcgaatacgttcgaatgggggagttcgcgtggcga
cgaatcgaaccggagcgagggacgttcgatttcgcgtggttagacgagaccgtcgaactc
atcgggaagtccggtatgaaagcggttctgtgcacgccgacagcgacgccgccgaaatgg
ctcgtcgacgaacatcccgacgttcgacagcgagagcaagacggtacgccgcgtgagtgg
gggagccgtcggttcacctgtttcaactcacccacctaccgttccgagaccgaacgcatc
gttagcgtgctgaccgaccgatacgccgacaacccccacgtcgccgggtggcagactgac
aacgaattcggctgtcacgagacggttacctgctactgcgaggactgtggcgaggcattt
agcgaatggctcgccgaccgctatgagagcgttgccgacctcaacgacgcgtggggaacg
acgttttggagccagcagtacgacgatttcgagagtatcgaccccccaaaaccgacaccg
gccgccaaccacccttcgcgggtactcgcctacgaacggtttagtaacgacagcgtggcc
gagtacaaccgcctgcacgcagccctcatccgcgaagcaaacgacgagtggttcgtcacg
cacaacttcatgggtggtttttcactcgacgcctttcgcctcgccgacgacctcgatttc
ctctcgtgggactcctatccgacggggttcgtgcaggaccgacagccggacacgccgacg
gtcgacgaattacgagcggggaaccccgaccaagtgagcatgaaccacgacctccagcgc
ggcgcgaaaggaaagccgttctgggtgatggagcaacagccgggagacatcaactggccg
ccgcagtcgccgcaaccggccgacggggcgatgcgcctgtgggctcaccacgccgtcgcc
cacggcgcggacgccgtcgtctacttccgctggcgtcgctgtcgtcaagggcaagaacag
taccacgccgggcttcggcggcaggacggctctccggaccgcgggtaccgcgaagcatcg
accgccgccgacgaactgttcgacttggattcggtcgatgcgtcagtcgcgctcgtccac
gactacgagagcctgtgggcgacgcgttcgcaacctctctcgcccgactgggactactgg
aaccacttacggacgtactacgatgcgcttcgcgcagacgttgagcctccctccggagta
acctcatccttacggacgtactacgatgcgcttcgcgcccgcggcgtgcaggtcgacatc
gtctcgccggaagcgactctcgaacggtacgacgcggtcgtcgcaccgactttgtatctc
gtcggcgacgaactgtcgaccgcgctgaccgactacgtcgattcgggtggctgtctcctc
ctcggtgctcgaacgggggagaaagacccgtacaaccggcttcacgagtcgctcgcgccg
ggaccactcaccgctctcaccggcgcgcaggtggcgcgtcacgaaacgcttcccgaccac
gtcgagacgcgactctcctacgacggtgcgacgtacgagttccgaacgtgggcttcgtgg
ctggcccccgaagtcggagttccacgaggcgagtaccggacgggtgaagcagccggaaac
accgcaatcgtgcggaacgccgccggagacgggagcgtgacgtactgtggctgctggccg
ggggacgaccttgccgacgcactcgtgacagagttactggacgccgccggcgtcgagtac
actgagcgattcccggacggcgtgcgcgtgatggagcgcgacggctatacgtgggcgctt
aacttcacgagcgacccggtgacgttgaccgtccccgattccaccgggttcctgctcggt
gagtccaccgtcgacgcgttcgataccgcggtactcgacggatccatccgaggtgtcgga
ctcgcgtccgagtga

DBGET integrated database retrieval system