KEGG   Haloferax volcanii: HVO_A0326Help
Entry
HVO_A0326         CDS       T01200                                 

Gene name
bgaH
Definition
beta-D-galactosidase
Orthology
K12308  
beta-galactosidase [EC:3.2.1.23]
Organism
hvo  Haloferax volcanii
Pathway
Galactose metabolism
Class
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:hvo00052]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
pHV4:complement(336439..338493)
Genome map
AA seq 684 aa AA seqDB search
MTVGVCYFPEHWSRERWETDISQMAEAGIEYVRMGEFAWRRIEPERGTFDFAWLDETVEL
IGKSGMKAVLCTPTATPPKWLVDEHPDVRQREQDGTPREWGSRRFTCFNSPTYRSETERI
VSVLTDRYADNPHVAGWQTDNEFGCHETVTCYCEDCGEAFSEWLADRYESVADLNDAWGT
TFWSQQYDDFESIDPPKPTPAANHPSRVLAYERFSNDSVAEYNRLHAALIREANDEWFVT
HNFMGGFSLDAFRLADDLDFLSWDSYPTGFVQDRQPDTPTVDELRAGNPDQVSMNHDLQR
GAKGKPFWVMEQQPGDINWPPQSPQPADGAMRLWAHHAVAHGADAVVYFRWRRCRQGQEQ
YHAGLRRQDGSPDRGYREASTAADELFDLDSVDASVALVHDYESLWATRSQPLSPDWDYW
NHLRTYYDALRADVEPPSGVTSSLRTYYDALRARGVQVDIVSPEATLERYDAVVAPTLYL
VGDELSTALTDYVDSGGCLLLGARTGEKDPYNRLHESLAPGPLTALTGAQVARHETLPDH
VETRLSYDGATYEFRTWASWLAPEVGVPRGEYRTGEAAGNTAIVRNAAGDGSVTYCGCWP
GDDLADALVTELLDAAGVEYTERFPDGVRVMERDGYTWALNFTSDPVTLTVPDSTGFLLG
ESTVDAFDTAVLDGSIRGVGLASE
NT seq 2055 nt NT seq  +upstreamnt  +downstreamnt
atgacagttggtgtctgctatttcccggagcactggtcgcgagagcgctgggagaccgat
atcagtcagatggccgaggctggaatcgaatacgttcgaatgggggagttcgcgtggcga
cgaatcgaaccggagcgagggacgttcgatttcgcgtggttagacgagaccgtcgaactc
atcgggaagtccggtatgaaagcggttctgtgcacgccgacagcgacgccgccgaaatgg
ctcgtcgacgaacatcccgacgttcgacagcgagagcaagacggtacgccgcgtgagtgg
gggagccgtcggttcacctgtttcaactcacccacctaccgttccgagaccgaacgcatc
gttagcgtgctgaccgaccgatacgccgacaacccccacgtcgccgggtggcagactgac
aacgaattcggctgtcacgagacggttacctgctactgcgaggactgtggcgaggcattt
agcgaatggctcgccgaccgctatgagagcgttgccgacctcaacgacgcgtggggaacg
acgttttggagccagcagtacgacgatttcgagagtatcgaccccccaaaaccgacaccg
gccgccaaccacccttcgcgggtactcgcctacgaacggtttagtaacgacagcgtggcc
gagtacaaccgcctgcacgcagccctcatccgcgaagcaaacgacgagtggttcgtcacg
cacaacttcatgggtggtttttcactcgacgcctttcgcctcgccgacgacctcgatttc
ctctcgtgggactcctatccgacggggttcgtgcaggaccgacagccggacacgccgacg
gtcgacgaattacgagcggggaaccccgaccaagtgagcatgaaccacgacctccagcgc
ggcgcgaaaggaaagccgttctgggtgatggagcaacagccgggagacatcaactggccg
ccgcagtcgccgcaaccggccgacggggcgatgcgcctgtgggctcaccacgccgtcgcc
cacggcgcggacgccgtcgtctacttccgctggcgtcgctgtcgtcaagggcaagaacag
taccacgccgggcttcggcggcaggacggctctccggaccgcgggtaccgcgaagcatcg
accgccgccgacgaactgttcgacttggattcggtcgatgcgtcagtcgcgctcgtccac
gactacgagagcctgtgggcgacgcgttcgcaacctctctcgcccgactgggactactgg
aaccacttacggacgtactacgatgcgcttcgcgcagacgttgagcctccctccggagta
acctcatccttacggacgtactacgatgcgcttcgcgcccgcggcgtgcaggtcgacatc
gtctcgccggaagcgactctcgaacggtacgacgcggtcgtcgcaccgactttgtatctc
gtcggcgacgaactgtcgaccgcgctgaccgactacgtcgattcgggtggctgtctcctc
ctcggtgctcgaacgggggagaaagacccgtacaaccggcttcacgagtcgctcgcgccg
ggaccactcaccgctctcaccggcgcgcaggtggcgcgtcacgaaacgcttcccgaccac
gtcgagacgcgactctcctacgacggtgcgacgtacgagttccgaacgtgggcttcgtgg
ctggcccccgaagtcggagttccacgaggcgagtaccggacgggtgaagcagccggaaac
accgcaatcgtgcggaacgccgccggagacgggagcgtgacgtactgtggctgctggccg
ggggacgaccttgccgacgcactcgtgacagagttactggacgccgccggcgtcgagtac
actgagcgattcccggacggcgtgcgcgtgatggagcgcgacggctatacgtgggcgctt
aacttcacgagcgacccggtgacgttgaccgtccccgattccaccgggttcctgctcggt
gagtccaccgtcgacgcgttcgataccgcggtactcgacggatccatccgaggtgtcgga
ctcgcgtccgagtga

DBGET integrated database retrieval system