KEGG   Haloferax volcanii: HVO_B0002Help
Entry
HVO_B0002         CDS       T01200                                 

Definition
acetylornithine deacetylase
Orthology
K01439  
succinyl-diaminopimelate desuccinylase [EC:3.5.1.18]
Organism
hvo  Haloferax volcanii
Pathway
Lysine biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:hvo01230]
Metabolism; Amino acid metabolism; Lysine biosynthesis [PATH:hvo00300]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
pHV3:1555..2712
Genome map
AA seq 385 aa AA seqDB search
MDEELRSLLTSLVEIETENPPGDEAAAAQFVSDWLDSRGVSATLVEEPFPDRPQVAARVG
DGEPSVVLNGHLDVVPAGDRDQWTHPPYDPTVRDGRLYGRGSADMKCGVALAMLATVEFA
DAFESGALDGSLVFHAAVGEETAEPGTKTLLERGYDGTYGVVLEPTALRTATSAKGLGWY
EISVGGDPSHASRPDEGDNAIGNARPVLDALEAYDEEIRARSDSLVGRPTATVTRFEAGT
KENVVPESATITVDRRFVPAETVEEVDAEIDALLSDVTAEHDLNVEWTRTRVYESAAVPT
DSDIAARFRDAAAERADIDPEPWGIRAATDVRNLVNDAGMDAITWGPGSMAQAHAYDEYI
ELSEVEAGYDILRTALRGLFEAGAD
NT seq 1158 nt NT seq  +upstreamnt  +downstreamnt
atggacgaagagttacgctcgttgctcacgagtctcgtcgaaatcgagaccgagaatccg
ccgggggacgaggcggcggcggcgcagttcgtgtccgactggctggactcccgaggcgtc
tcggcgacgctcgtcgaggaaccgttccccgaccgaccgcaggtcgcggcccgcgtcggc
gacggcgaaccctcggtcgtcctcaacggccacctcgacgtggtcccggcgggcgaccga
gaccagtggacccatccaccgtacgacccgaccgtcagagacggcagactgtacggtcgc
gggagcgcggacatgaagtgcggcgtcgccctcgcgatgctcgcgacggtcgagttcgcc
gacgcgttcgagtccggcgcgctcgacggctcgctcgtgttccacgctgccgtcggcgag
gagacggccgaaccggggacgaagacgctcctcgaacgcggctacgacggcacctacggc
gtcgtgctcgaaccgacggcgttgcggaccgcgacgagcgcgaaggggctcggttggtac
gagatttccgtcggcggcgacccgtcgcacgcgagtcggcccgacgagggggacaacgcg
attgggaacgctcgtcccgttctcgacgcgctcgaagcgtacgacgaggagattcgggca
cgctccgactcgctcgtcggtcgcccgaccgcgacggtcacgcggttcgaggcggggacg
aaggagaacgtcgttccggagagcgcgaccatcacggtcgacaggcggttcgtccccgct
gagacagtcgaggaagtcgacgccgaaatcgacgcgctgctctccgacgtgacggccgaa
cacgacctgaacgtcgagtggacgcgaacgcgagtctacgaatcggcggcggttccgacc
gacagcgacatcgcggcgcgctttcgggacgcggccgccgagcgggcggatatcgacccc
gagccgtgggggattcgggcggcgaccgacgttcggaacctcgtcaacgacgccgggatg
gacgcgattacgtgggggccggggtcgatggcgcaggcccacgcctacgacgagtacatc
gaactgtcggaggtcgaagccgggtacgacatcctccgcacggcgctccgcgggctgttc
gaggccggcgcagactga

DBGET integrated database retrieval system