KEGG   Haloferax volcanii: HVO_B0256Help
Entry
HVO_B0256         CDS       T01200                                 

Gene name
aor3
Definition
aldehyde ferredoxin oxidoreductase
Orthology
K03738  
aldehyde:ferredoxin oxidoreductase [EC:1.2.7.5]
Organism
hvo  Haloferax volcanii
Pathway
Pentose phosphate pathway
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:hvo00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    HVO_B0256 (aor3)
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    HVO_B0256 (aor3)
Enzymes [BR:hvo01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.5  aldehyde ferredoxin oxidoreductase
     HVO_B0256 (aor3)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
pHV3:complement(302870..304537)
Genome map
AA seq 555 aa AA seqDB search
MLHAKGPLLTVDLGDETSRTEDIDGILESYVGGRGVATRLAHERVPFDVDPFSPDNRVYF
STGPMQASNMSFTGRTNCTSVSPLTGGLCSSNAGGFVSRNFADAGYSAVELAGVSDELVV
LHVTDEGVEFEAVPDLAGATVPETVAYLDDEHDIEADRTMVVGPAGENLVRFASIMTSEE
RAFGRGGLGAVLGSKNVKALTFGGDAAPDIEIPASQMEIHREAATDDHIMKRQGTVAVLD
LANEMDGLPSYYFSERHFEGAEGINGDAIEQKKYKKGTCSACAFACKLPTRDEAAGVETE
GPEFEVTMAFGSNSGVDDIVEVMKSNELCDRYGLDAISAGNTVAAYLASEDEFGNTDLIH
DLVEKIALREGVGDDLAEGIARVHDDLGVENWTVKGMDFAAHEGRVLHGQGLSYAVANRG
ADHMYAVFYSQEYPLVGKDDAYPPEGFEGKPKRLIEKENQMALNDSGIVCKFSRDFMTPE
RYEMLFGADFEDLLAVGDRIVTLERHFNNQRGFDRGDDTLPYADELDGFEAALDAYYERR
GWTDDGVVPSGNVPA
NT seq 1668 nt NT seq  +upstreamnt  +downstreamnt
atgttacacgcaaaaggtccgcttctcacggtcgacctgggggacgagacgagtcggacg
gaagacatcgacgggattctcgaatcctacgtcggcgggcgcggggtcgccactcgactc
gcccacgagcgcgttcccttcgacgtggacccgttcagcccggacaaccgggtgtacttc
agtaccggcccgatgcaggcgtcgaacatgagcttcaccggccgcacgaactgcaccagc
gtctcgcctttgaccggcggcctctgctcgtcgaacgccggcgggttcgtctcgcggaac
ttcgctgacgcgggctactcggcggtcgaactcgcgggcgtgagcgacgaactggtcgtc
ctccacgtcacagacgagggcgtcgagttcgaggccgtcccggacctcgccggcgcgacg
gtccccgagacggtcgcgtacctcgacgacgaacacgatatcgaagccgaccggacgatg
gtcgtcggccccgccggcgagaacctcgtgcgcttcgcctccatcatgacgagcgaggag
cgcgcgttcggccgcggcggcctcggtgccgtcctcgggtcgaagaacgtgaaggcgctc
acgttcggcggcgatgccgcgcccgacatcgagattccggcgtcgcagatggagattcac
cgcgaggccgccaccgacgaccacatcatgaagcggcaggggaccgtcgccgtgctggac
ctcgccaacgagatggacggcctcccgtcgtactacttctccgagcgtcacttcgagggc
gcggagggcatcaacggcgacgccatcgagcagaagaagtacaagaagggaacctgctcg
gcctgcgcgttcgcgtgtaagctccccacgagagacgaggcggcgggcgtcgagaccgag
gggcccgagttcgaagtcaccatggcgttcgggtcgaactccggcgtcgacgacatcgtg
gaagtgatgaagtcgaacgagctgtgcgaccgctacggtctcgacgccatctcggccggc
aacaccgtcgcggcctacctcgccagcgaagacgagttcggcaacaccgacctcatccac
gacctcgtggagaaaatcgcgctccgtgagggcgtcggcgacgacctcgccgagggcatc
gcccgcgtgcacgacgacctcggcgtggagaactggacggtcaaggggatggacttcgcc
gcccacgagggccgcgtcctccacggacagggactgtcgtacgccgtcgccaaccgcggc
gcggaccacatgtacgcggtgttctactcgcaggagtacccgctggtcggcaaggacgac
gcctacccgccggaggggttcgagggcaaacccaagcgcctcatcgagaaggaaaaccag
atggcgctcaacgacagcggcatcgtctgcaagttctcgcgggacttcatgacgcccgaa
cgctacgagatgctgttcggagccgatttcgaggacctgctggccgtcggcgaccgcatc
gtcacgctcgaacgccacttcaacaaccagcgcggcttcgaccgcggcgacgacacgctc
ccgtacgccgacgagctagacgggttcgaggcggcgctcgacgcgtactacgagcgtcgc
ggctggaccgacgacggcgtcgtcccgtccggaaacgtcccggcgtaa

DBGET integrated database retrieval system