KEGG   Haloferax volcanii: HVO_B0300Help
Entry
HVO_B0300         CDS       T01200                                 

Definition
Uricase
Orthology
K00365  
urate oxidase [EC:1.7.3.3]
Organism
hvo  Haloferax volcanii
Pathway
Purine metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:hvo00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    HVO_B0300
  Biosynthesis of other secondary metabolites
   00232 Caffeine metabolism
    HVO_B0300
Enzymes [BR:hvo01000]
 1. Oxidoreductases
  1.7  Acting on other nitrogenous compounds as donors
   1.7.3  With oxygen as acceptor
    1.7.3.3  factor-independent urate hydroxylase
     HVO_B0300
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
pHV3:complement(346679..347605)
Genome map
AA seq 308 aa AA seqDB search
MNYGKENVAVYRTYATPLEGVRTIPESSFDGRDNVLFGLDVRVQVEGEEFLPSFSEGDNT
KVVATDSMKNFILHHAGEYDGATLEGFLEFVGSGFLDTYSQMSAVEVSADEIRFDELPVP
EDDGDGYEASDLVFRVSDNESGYGSISLTRDDGTPVITDQTSGVTGLELVKVEGSSFTGY
VQDEYTTLPEREDRTLYISLDIFWSYDDPEDALGEDPERYVPSEQVRDIAHVVFDEVDSN
SIQDLIYQIGLRVLERYPQLASVRFEANNRTWLSVRDDLDGDASVLREPPAPTGFQQFSM
DRGDLDEQ
NT seq 927 nt NT seq  +upstreamnt  +downstreamnt
atgaactacgggaaggagaacgtcgccgtctaccggacgtacgcgaccccgctggagggc
gttcgcacgattccggagtcgtcgttcgacgggcgggacaacgtgctgttcggcctcgac
gttcgcgtgcaggtcgaaggcgaggagttcctgccgtcgttcagcgagggcgacaacacg
aaggtcgtggcgacggactcgatgaagaacttcatcctccaccacgccggcgagtacgac
ggggccaccctcgaaggcttcttggagttcgtcgggtcggggttcttggacacctactcg
cagatgagcgccgtcgaggtgtcggccgacgagattcgattcgacgaactgcccgtccca
gaggacgacggcgacgggtacgaggcgagcgacctcgtcttccgcgtctccgacaacgag
tccggctacggctccatctcgctgacgcgagacgacggcacacccgtcatcaccgaccag
acgagcggcgtcaccggcctcgaactggtcaaggtcgaggggagttcgttcaccggctac
gtccaagacgagtacacgacgctcccggagcgcgaggaccgaacgctctacatctcgctc
gatatcttctggagctacgacgaccccgaagacgcgctcggcgaggaccccgaacggtac
gtgccgtccgagcaggtccgcgacatcgcccacgtcgtcttcgacgaggtcgactcgaac
tcgattcaggacctcatctaccaaatcggcctgcgcgtcctcgaacgctatccgcagctc
gcgtccgttcggttcgaggcgaacaaccgcacctggctcagcgtccgcgacgacctcgac
ggcgacgccagcgtcctgcgggagccgcccgcgccgaccggcttccagcagttctcgatg
gaccgcggcgacctcgacgagcagtaa

DBGET integrated database retrieval system