KEGG   Haloferax volcanii: HVO_B0343Help
Entry
HVO_B0343         CDS       T01200                                 

Gene name
lplD
Definition
hydrolytic enzyme lplD
Orthology
K07406  
alpha-galactosidase [EC:3.2.1.22]
Organism
hvo  Haloferax volcanii
Pathway
Galactose metabolism
Glycerolipid metabolism
Brite
KEGG Orthology (KO) [BR:hvo00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    HVO_B0343 (lplD)
  Lipid metabolism
   00561 Glycerolipid metabolism
    HVO_B0343 (lplD)
   00600 Sphingolipid metabolism
    HVO_B0343 (lplD)
Enzymes [BR:hvo01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.22  alpha-galactosidase
     HVO_B0343 (lplD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
pHV3:complement(395884..397317)
Genome map
AA seq 477 aa AA seqDB search
MYQLSEQAEPVPSGSSRTIDIGYIGGGSQGWAHTLINDLAQCPDLAGSVTLYDVNYEMAS
KNALLGNRVMDREEAAGDWSFEATRSMDKALDGADFVICSIQDPPGETFVHDIDVPQEYG
IYQTVADTVGPGGAIRALRAIPQYRDIAATVRERCPDAWVINYTNPMTVCTRALYEEFPD
INAIGLCHEVFKTQELFADMAERYIDEAEDVARDEVRVNVKGVNHFTWVDEARWRDRDVF
QYLDEELDRRKPLFDRESGDLDAESYWVNNEEVALDLYDRFGVLGAAGDRHLVEFVPWYL
SIDEPAEIQRYGIRLTPSSARVSDDEGPDEMERYLEGDAAFEFRESGEEAVDIMRALSGE
GTFVTHLNYPNEGQVDGLPEGAVVETNALLSGDDVTPLCAGGLPDEVESMVQTHVTNQET
LVRAGFEGDLDLAFQAFLNEPLVTVSRDEAQELFAKLVELEREYFTDYDLDASVLRA
NT seq 1434 nt NT seq  +upstreamnt  +downstreamnt
atgtatcagctgtcggagcaggcggagcctgtaccgtcgggttcgtcccgaaccatcgac
atcggctacatcggcggcgggagtcaggggtgggcccacacgctcatcaacgacctcgcg
cagtgtcctgacctcgcggggagcgtcacgctgtacgacgtgaactacgagatggcgtcg
aagaacgccctcctcggcaaccgcgtgatggaccgcgaggaggcggccggtgactggtcg
ttcgaggcgacccggagcatggacaaggcgctcgacggggccgacttcgtcatctgttcg
attcaggacccgccgggcgagacgttcgtccacgacatcgacgtgccacaggagtacggc
atctatcagacggtcgccgacaccgtcggtcccggcggggcgattcgggcgctgcgtgcg
attccgcagtaccgcgacatcgccgcgacggtccgcgagcgctgcccggacgcgtgggtt
atcaactacaccaacccgatgacggtctgcacgcgggcgctctacgaggagttccccgac
atcaacgccatcgggctctgccacgaggtgttcaagacgcaggagctgtttgccgacatg
gcggagcgctacatcgacgaggccgaggacgtcgcccgcgacgaggttcgagtgaacgtc
aagggcgtcaaccacttcacgtgggtcgacgaggcgcggtggcgcgaccgcgacgtgttc
cagtacctcgacgaggaactcgaccgccggaagccgcttttcgaccgcgagtcgggcgac
ctcgacgccgagtcctactgggtgaacaacgaggaagtcgcgctcgacctctacgaccgc
ttcggcgtcctcggcgcggcgggcgaccgtcacctcgtggagttcgtcccgtggtatctg
agcatcgacgagccggcggaaatccagcgctacggcatccggctcacgccgagttcggcc
cgcgtctccgacgacgagggtccggacgagatggagcgctacctcgaaggcgacgcggcg
ttcgagttccgcgagtccggcgaggaggcggtcgacatcatgcgggcgctctccggcgag
gggacgttcgtcacgcacctcaactaccccaacgaggggcaggtcgacggtctccccgag
ggcgcggtggtggagacgaacgcgctcctctccggcgacgacgtgacgcccctctgtgcg
ggcggcctgcccgacgaggtcgagagcatggtgcaaacccacgtcacgaatcaggagacg
ctcgtccgcgcgggcttcgagggcgacctcgacctcgcgtttcaggcgttcctcaacgaa
ccgctcgtcaccgtctcgcgcgacgaggcacaggagttgttcgcgaaactcgtcgaacta
gagcgggagtacttcacggactacgacctcgacgcgtcggtcctgcgggcgtaa

DBGET integrated database retrieval system