KEGG   Haloquadratum walsbyi DSM 16790: HQ1024AHelp
Entry
HQ1024A           CDS       T00375                                 

Gene name
pmm
Definition
(RefSeq) phosphohexomutase (phosphoglucomutase; phosphomannomutase) (EC:5.4.2.2 5.4.2.8)
  KO
K15778  
phosphomannomutase / phosphoglucomutase [EC:5.4.2.8 5.4.2.2]
Organism
hwa  Haloquadratum walsbyi DSM 16790
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Purine metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:hwa00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    HQ1024A (pmm)
   00030 Pentose phosphate pathway
    HQ1024A (pmm)
   00051 Fructose and mannose metabolism
    HQ1024A (pmm)
   00052 Galactose metabolism
    HQ1024A (pmm)
   00500 Starch and sucrose metabolism
    HQ1024A (pmm)
   00520 Amino sugar and nucleotide sugar metabolism
    HQ1024A (pmm)
  Nucleotide metabolism
   00230 Purine metabolism
    HQ1024A (pmm)
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    HQ1024A (pmm)
Enzymes [BR:hwa01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.2  phosphoglucomutase (alpha-D-glucose-1,6-bisphosphate-dependent)
     HQ1024A (pmm)
    5.4.2.8  phosphomannomutase
     HQ1024A (pmm)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(30255..31634)
Genome map
AA seq 459 aa AA seqDB search
MKLFGSSGTRGVVGEGITPELVLQVAKAAGTVWEANQAIIARDTRTSSQSFVNAAVSGLT
SVGIDVIRLGVTPTPSVVHYAGETDRPGIVITASHNPPEYNGVKLIGETGVEIGVEGLER
IEACVLNEDFTPASWDNIGSITRTETVNTEYVDKLLTALEQDGSREAIADANLTVAIDPG
HGAGCLTSPQFFRKLGCDVVTVNATPDGHFPGRPSEPIASNLTALRSLVTASNADIGIAH
DGDADRAVFIDEQGKQIAGEASLAALAAAELDSNSATVAAVNVSQRLVDVCNRVGATLEL
TPIGSTNIITRIQELQKSGVSVPVAGEGNGGIFFPKFRLVRDGAYIGAKFLRLICEQPAS
SIIEPYTKYANARINIEHGSEKELEALMRGAEEFAEEADVTPNIIDGYRLDYDDAWVLIR
PSGTEPVVRVYAEAKEQTQAQTLADDAAGKLYDATDDIG
NT seq 1380 nt NT seq  +upstreamnt  +downstreamnt
atgaagctgttcggttcgagtggcactcgaggggttgttggggaggggataacacctgaa
ctcgtactacaagtcgcgaaggcggctgggacggtatgggaggctaatcaggctatcatc
gcacgtgatactcgaacaagcagtcagtccttcgtgaatgcggctgtgagcgggcttaca
agtgtcgggattgatgtcatacgacttggagtgactccaactcctagtgtggtccattat
gccggtgaaactgatcgccctggcatagtaatcaccgcatcacacaatccaccggagtat
aatggagtgaagctcatcggagaaactggggttgagattggggttgaggggcttgaacgg
attgaagcatgtgtgctcaatgaggattttacaccggcatcatgggataatataggatcg
ataacgcggactgaaacggtcaatactgaatatgtcgataagttgctcactgcacttgaa
caagatgggtctcgtgaggcaattgcagatgctaatcttactgtcgctattgatccagga
catggagcaggatgtctgaccagcccacagttttttcgtaaacttggatgcgatgtcgtg
acggtgaatgcaacaccggatggtcattttcctggtcgtccgtctgaaccaatcgcttca
aaccttactgcgcttcggtcgcttgtgaccgcctcgaacgccgatattggtattgcacac
gatggtgatgccgaccgcgctgtcttcattgatgaacaagggaaacaaatcgccggtgag
gcatcacttgctgcacttgccgcggctgaacttgatagcaatagcgcaaccgttgctgcg
gtgaatgtatcacaacgccttgttgacgtatgtaaccgtgttggcgctacactagaacta
accccaattgggtcaacaaatattattacaaggattcaggaattacagaaatccggagtg
tcagtcccagttgctggcgaaggtaacgggggtatattttttccgaagttccggttggtt
cgtgatggagcatatatcggagcgaagttcctgcgattaatttgtgaacagccagcgagt
agtatcattgagccatatactaagtatgcaaacgcccgaatcaatattgaacatggttct
gagaaagagctagaggcgttaatgagaggtgcggaggagtttgcagaggaagctgatgta
acaccaaacataattgatggatatcggcttgattatgatgacgcatgggtgcttattcgg
ccgtcaggaacagaaccggtagtacgggtgtacgcagaagcaaaagaacagactcaagca
caaacccttgctgatgacgctgcaggtaaattgtatgacgctactgatgatattggatag

DBGET integrated database retrieval system