KEGG   Haloquadratum walsbyi DSM 16790: HQ1042AHelp
Entry
HQ1042A           CDS       T00375                                 

Gene name
thrC
Definition
threonine synthase (EC:4.2.3.1)
Orthology
K01733  
threonine synthase [EC:4.2.3.1]
Organism
hwa  Haloquadratum walsbyi DSM 16790
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:hwa00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    HQ1042A (thrC)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    HQ1042A (thrC)
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    HQ1042A (thrC)
Enzymes [BR:hwa01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     HQ1042A (thrC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
46022..47287
Genome map
AA seq 421 aa AA seqDB search
MSLELSAAAPAIPPEATDGVWLADIETGETYAPFEEIRYTSDEDNLLEVRYADLPTFEDF
QGQGRGVWRYHAALPFENGVSLPEGDTPLHRAPSIRDAAGVRSLRIKHEGMNPTGSFKDR
GMTVGVRVAKELGVGRLACASTGNTSAALAAYGARGGMQTLVLLPAGKVAAGKIAQAALH
DARILEVDGNFDDCLDIVQDLARRGEVYLLNSLNPFRLEGQKTIGLEILERFYEEYGRFP
DRIILPVGNAGNTSALYKAFRELVQSGALRPSEVPKLTGVQAAGAAPMVEAVEHGWSDIE
RWDDVETRATAIRIGNPVNAPKALPGIRETGGTAIAVTDDEITVAQRDLAREGIGVEPAS
AASVAGLKKLRGRSRIDSDEDVVCLTTGHLLKDPDEAFKAGGNPEPVGGDTDAVLEHIGA
N
NT seq 1266 nt NT seq  +upstreamnt  +downstreamnt
atgagtcttgaacttagcgccgccgccccagccatccccccggaggccaccgacggtgtc
tggctcgcggatatcgaaacgggagaaacatacgccccgttcgaggagatccgctatacg
agcgatgaggataatttacttgaggttcggtatgccgaccttccaacatttgaagatttc
cagggacagggtcgcggtgtctggcgatatcacgctgctcttccgtttgagaatggagtt
agccttcctgagggagatacaccacttcatcgagcacccagtattcgggatgcagccggt
gttcgctcattgcgtattaaacatgaggggatgaacccaactggatcattcaaggatcgt
ggtatgactgttggtgtccgagttgcgaaagaacttggcgttggacggctcgcttgtgca
tcaacggggaatacatctgccgcacttgccgcatacggtgcgcgcggtgggatgcaaacg
cttgtgttgttacccgctggaaaggttgcagccggaaagatcgctcaagccgcacttcat
gacgcccgtatcttagaagtcgatggcaactttgatgattgtctcgatatcgtccaggat
cttgctcggcgtggtgaagtgtatttgttgaactcattaaatccattccgacttgaggga
cagaaaacaatcgggcttgaaattctcgaacgattttacgaggagtatggtcgattccct
gatcgaattatccttccggttggtaatgccggtaatacttcagctttatataaagcgttc
cgcgagttggtccaatcgggagcactcagaccaagtgaagttccaaagctcacgggcgtc
caagcggcaggcgcagcaccaatggttgaagcggttgagcatggatggtcggatatcgag
cgctgggatgatgttgaaacccgagcaacagcaattcggattggaaatccagttaacgct
ccgaaggcgcttccagggattcgtgaaaccggcggcacagctattgcagtgactgatgat
gagattactgttgctcaacgtgatctcgcacgggagggcattggtgtcgagcccgcatcc
gcagcctctgttgctggattaaagaaactccgtggtcggagtcgaatcgacagtgatgaa
gacgttgtttgtcttaccaccggacatctgctaaaggaccccgatgaagcattcaaggct
ggcggtaatccagaacccgttggcggtgacactgacgctgtcttagagcatatcggcgcg
aattga

DBGET integrated database retrieval system