KEGG   Haloquadratum walsbyi DSM 16790: HQ1042AHelp
Entry
HQ1042A           CDS       T00375                                 

Gene name
thrC
Definition
threonine synthase (EC:4.2.3.1)
Orthology
K01733  
threonine synthase [EC:4.2.3.1]
Organism
hwa  Haloquadratum walsbyi DSM 16790
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:hwa01230]
Metabolism; Amino acid metabolism; Glycine, serine and threonine metabolism [PATH:hwa00260]
Metabolism; Metabolism of cofactors and vitamins; Vitamin B6 metabolism [PATH:hwa00750]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
46022..47287
Genome map
AA seq 421 aa AA seqDB search
MSLELSAAAPAIPPEATDGVWLADIETGETYAPFEEIRYTSDEDNLLEVRYADLPTFEDF
QGQGRGVWRYHAALPFENGVSLPEGDTPLHRAPSIRDAAGVRSLRIKHEGMNPTGSFKDR
GMTVGVRVAKELGVGRLACASTGNTSAALAAYGARGGMQTLVLLPAGKVAAGKIAQAALH
DARILEVDGNFDDCLDIVQDLARRGEVYLLNSLNPFRLEGQKTIGLEILERFYEEYGRFP
DRIILPVGNAGNTSALYKAFRELVQSGALRPSEVPKLTGVQAAGAAPMVEAVEHGWSDIE
RWDDVETRATAIRIGNPVNAPKALPGIRETGGTAIAVTDDEITVAQRDLAREGIGVEPAS
AASVAGLKKLRGRSRIDSDEDVVCLTTGHLLKDPDEAFKAGGNPEPVGGDTDAVLEHIGA
N
NT seq 1266 nt NT seq  +upstreamnt  +downstreamnt
atgagtcttgaacttagcgccgccgccccagccatccccccggaggccaccgacggtgtc
tggctcgcggatatcgaaacgggagaaacatacgccccgttcgaggagatccgctatacg
agcgatgaggataatttacttgaggttcggtatgccgaccttccaacatttgaagatttc
cagggacagggtcgcggtgtctggcgatatcacgctgctcttccgtttgagaatggagtt
agccttcctgagggagatacaccacttcatcgagcacccagtattcgggatgcagccggt
gttcgctcattgcgtattaaacatgaggggatgaacccaactggatcattcaaggatcgt
ggtatgactgttggtgtccgagttgcgaaagaacttggcgttggacggctcgcttgtgca
tcaacggggaatacatctgccgcacttgccgcatacggtgcgcgcggtgggatgcaaacg
cttgtgttgttacccgctggaaaggttgcagccggaaagatcgctcaagccgcacttcat
gacgcccgtatcttagaagtcgatggcaactttgatgattgtctcgatatcgtccaggat
cttgctcggcgtggtgaagtgtatttgttgaactcattaaatccattccgacttgaggga
cagaaaacaatcgggcttgaaattctcgaacgattttacgaggagtatggtcgattccct
gatcgaattatccttccggttggtaatgccggtaatacttcagctttatataaagcgttc
cgcgagttggtccaatcgggagcactcagaccaagtgaagttccaaagctcacgggcgtc
caagcggcaggcgcagcaccaatggttgaagcggttgagcatggatggtcggatatcgag
cgctgggatgatgttgaaacccgagcaacagcaattcggattggaaatccagttaacgct
ccgaaggcgcttccagggattcgtgaaaccggcggcacagctattgcagtgactgatgat
gagattactgttgctcaacgtgatctcgcacgggagggcattggtgtcgagcccgcatcc
gcagcctctgttgctggattaaagaaactccgtggtcggagtcgaatcgacagtgatgaa
gacgttgtttgtcttaccaccggacatctgctaaaggaccccgatgaagcattcaaggct
ggcggtaatccagaacccgttggcggtgacactgacgctgtcttagagcatatcggcgcg
aattga

DBGET integrated database retrieval system