KEGG   Haloquadratum walsbyi DSM 16790: HQ1124AHelp
Entry
HQ1124A           CDS       T00375                                 

Gene name
adh
Definition
alcohol dehydrogenase (EC:1.1.1.1)
Orthology
K00001  
alcohol dehydrogenase [EC:1.1.1.1]
Organism
hwa  Haloquadratum walsbyi DSM 16790
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:hwa00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    HQ1124A (adh)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    HQ1124A (adh)
  Lipid metabolism
   00071 Fatty acid degradation
    HQ1124A (adh)
  Amino acid metabolism
   00350 Tyrosine metabolism
    HQ1124A (adh)
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    HQ1124A (adh)
   00626 Naphthalene degradation
    HQ1124A (adh)
Enzymes [BR:hwa01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     HQ1124A (adh)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(180479..181516)
Genome map
AA seq 345 aa AA seqDB search
MSAAVYYGPRDIRVENVVKPTLEESTDAVVRVTHTAVCGSDLWFYRGKTDRDIPSRVGHE
PMGIVEEVGDDVQSVDVGDRVFAPFKISCGMCEFCRRGLHTSCVNGDGWGDDNGGAQGEV
IRCRHADGTLVRVPDAYANDDSALRSILPLTDVMGTGHHAAVSAGVSAGSTCVVVGDGAV
GLCGVLAARRLGAARIVAVGHHPDRLSLASEFGATDTVSARGQEAIETVQEMTGGGAEHV
LECVGATSAMETAVEVCRPGGTVGYVGVPHGLDDGLDLFSFFGDNITLQGGVAPVRAYAD
ELLADVLQGTLDPAPVFTKTVDLDSISEGYQAMDERDAIKVLVEI
NT seq 1038 nt NT seq  +upstreamnt  +downstreamnt
atgagtgctgctgtttactatggtccccgtgatatccgcgttgagaatgttgttaaaccg
acgttagaagagtcaacagacgcagttgtccgggttacacataccgccgtctgtgggtcc
gatttgtggttttatcgaggaaagacagaccgcgacattccttctcgagttggtcatgaa
ccaatgggtattgttgaagaagtcggcgatgatgtgcagtctgttgatgtcggggatcgt
gttttcgcaccatttaagataagttgtggtatgtgtgaattttgtcgtcgtggattgcat
acatcatgtgtgaatggtgatggttggggcgatgacaatggtggtgcacaaggtgaggtg
attcgctgccgacatgcagatggaacgcttgttcgtgttccagatgcttatgccaacgac
gatagcgcacttcggtccatactcccgctgacagatgtcatggggacaggtcatcatgca
gcggtgagtgcaggtgttagcgccgggtcgacgtgtgtcgtcgtcggcgatggggctgtt
gggctctgtggtgtgcttgcggctcgccggttaggggctgcgcgaatcgtcgctgtcgga
catcacccagatcgattatcacttgcgagtgaatttggcgctaccgatacagtctccgca
cgcgggcaagaagctattgagaccgttcaagagatgactggtggcggtgctgaacatgtg
cttgaatgcgtcggtgcaacgagcgcaatggaaaccgctgttgaggtgtgtcgacccgga
gggacagtcgggtacgttggtgttccacatgggcttgacgatggtcttgatctattttcc
ttctttggggataatattacgctacaaggcggtgttgctcccgtccgtgcatatgcagat
gaactgttagctgacgtccttcaggggacgcttgatcctgcaccagtgtttacaaaaacc
gttgatcttgattcaatatcggagggatatcaagcgatggacgaacgggatgcgattaag
gttcttgttgagatataa

  All links  
No link information was found.   
DBGET integrated database retrieval system