KEGG   Haloquadratum walsbyi DSM 16790: HQ1158AHelp
Entry
HQ1158A           CDS       T00375                                 

Gene name
trpB
Definition
tryptophan synthase subunit beta (EC:4.2.1.20)
Orthology
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
hwa  Haloquadratum walsbyi DSM 16790
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:hwa00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    HQ1158A (trpB)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    HQ1158A (trpB)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    HQ1158A (trpB)
Enzymes [BR:hwa01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     HQ1158A (trpB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(217904..219151)
Genome map
AA seq 415 aa AA seqDB search
MTQRYADGKFGEYGGQYVPEALMPAIEELTDAYERYVLENEDGFMDEFRARLRDFGGRPT
PTEYAERLSERHGCDVYLKREDLLHGGAHKLNNALGQALLAKYMGKERIIAETGAGQHGT
ATAMAAAHLDMPCEVYMGERDINRQRPNVFRMRLNGSEVTPVTIGRGTLKEAISETMRDW
ATNVEDTHYIIGSIVGPHPFPSMVRDFHAVISEEARRQVREQTGGLPDAVLACAGGGSNT
MGTFAHFIDDTDVDLYAVEAGGSSLEVDEDAGVAPNSASLSTGDEGVLHGARTKLLQDSD
GQIMESHSVSSGLDYAGVGPELAHLVDTDRVNPVNVDDEATLAAFHRVSQLEGVIPALET
AHAFGYLEEQGGALGDSILINVSGRGDKDLEIAIEETAEHDIDIAPDMSEFAGGL
NT seq 1248 nt NT seq  +upstreamnt  +downstreamnt
atgacacaacgatacgcagacgggaaattcggcgaatatggcggacagtacgttccagag
gcattgatgcctgctattgaggaattaactgacgcgtatgagcgttacgtgttagagaat
gaagacggattcatggatgagttccgagcacgacttcgagatttcggtggtcgaccaaca
ccaacggagtacgcagagcgtctatcagagcgacatggctgtgatgtatatttgaagcgc
gaagatcttctccacggtggtgcacataagcttaataatgccctcggacaggcgttatta
gcgaaatatatgggtaaagagcgaattatcgctgagaccggtgccggtcagcatggcaca
gcaactgcgatggcagccgctcatctcgatatgccctgtgaagtgtatatgggtgagcgc
gatattaatcgacagcgtccgaatgtattccgaatgcgactcaacgggtcagaggtaacg
cctgttacaatcggtcgtggaacactcaaagaagctatctctgaaacgatgcgtgattgg
gcaacaaacgtcgaagacacacattatattattggctcaattgtcggtccacatcccttc
ccgtcgatggttcgtgacttccacgcagttatttctgaggaggcacgacgacaggtgcgt
gaacagaccggtggacttcccgatgctgtgttggcatgtgctggtggagggtcaaacaca
atggggacatttgcacactttatcgatgatacggatgttgacctctatgctgttgaagca
ggcggatcaagtcttgaggttgacgaagatgctggtgttgcaccgaattcagcatcatta
tcaaccggcgatgagggcgttctgcacggtgcacgaaccaagctactgcaggatagtgat
ggtcagattatggaaagccacagcgtctcttcggggcttgattatgctggtgttggtccg
gaactcgcacatcttgtcgatacggaccgtgtgaatccagtaaatgttgatgatgaagcc
acacttgctgcatttcatcgagtctcacaactggagggtgttattccagcacttgagact
gcacatgcctttggatatcttgaagaacaggggggtgctctcggcgacagtatattaatt
aatgtttccggacgcggtgataaagatctggaaatagcgattgaggagaccgctgaacac
gacatcgatattgctcccgatatgtctgaatttgctggaggattgtga

DBGET integrated database retrieval system