KEGG   Haloquadratum walsbyi DSM 16790: HQ1355AHelp
Entry
HQ1355A           CDS       T00375                                 

Gene name
thrC
Definition
threonine synthase (EC:4.2.3.1)
Orthology
K01733  
threonine synthase [EC:4.2.3.1]
Organism
hwa  Haloquadratum walsbyi DSM 16790
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:hwa00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    HQ1355A (thrC)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    HQ1355A (thrC)
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    HQ1355A (thrC)
Enzymes [BR:hwa01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     HQ1355A (thrC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
449749..450549
Genome map
AA seq 266 aa AA seqDB search
MISTATRLEANRVVEDSSGNAGTAVATYAARAGIDAEIYVPASIKPAKRRAIERTGATPI
SIEGSREQVTKACIETVKSDEAWYASHAWNPAFFAGTAAFAYEVCAQRGWSAPDVVVMPL
GHGTLFLGAYRGFVDLLNAGWIDSLPRLLGAQATGYAPIARELHDISIAPTKVNNRADGI
QIAEPVRRKQILTAINATDGDAIALSADAVDTTVDALHARGFYTEPTCAIAPAALDVYRD
REIIVAHDDVAVPLTGSGLKTIYNKF
NT seq 801 nt NT seq  +upstreamnt  +downstreamnt
atgatttctaccgcaacaagacttgaagctaaccgcgttgttgaggattcatcagggaat
gctgggacagccgttgcgacgtatgctgcacgggcaggaattgatgctgaaatatatgtt
ccagcgtcaatcaagccagcaaaacgacgggcaattgaacgcactggggcaacgccgatt
agtatcgaaggatctcgtgagcaagtcacaaaagcgtgtattgaaaccgtgaagtccgat
gaggcgtggtatgcctcacatgcatggaatcccgccttctttgcggggacagcagcattc
gcatatgaagtatgtgcacagcgtggatggagtgcaccagacgtcgttgtaatgccgctt
ggtcacggtacattattccttggcgcatatcgtggctttgttgatctgttgaacgcggga
tggattgactcactcccgcgactccttggtgcacaggcgactggatatgcaccgatcgca
cgtgagcttcatgacatttcaatagcgccgacaaaagtgaataaccgtgctgatggaatc
cagattgcggaacctgtccgccgtaagcagatccttacagctattaatgccactgatggt
gatgcaattgcactttccgctgatgctgttgatacgacagtcgatgcacttcacgcccgg
gggttctatactgagcccacctgtgcaattgccccggctgcacttgacgtctatcgggat
cgggagataattgtagctcatgatgatgttgcggttccactcactggaagcgggctgaag
acgatatataacaaattttga

DBGET integrated database retrieval system