KEGG   Haloquadratum walsbyi DSM 16790: HQ1394AHelp
Entry
HQ1394A           CDS       T00375                                 

Gene name
gapB
Definition
glyceraldehyde-3-phosphate dehydrogenase (NAD(P)) (phosphorylating) (EC:1.2.1.59)
Orthology
K00134  
glyceraldehyde 3-phosphate dehydrogenase [EC:1.2.1.12]
Organism
hwa  Haloquadratum walsbyi DSM 16790
Pathway
Glycolysis / Gluconeogenesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis, core module involving three-carbon compounds
Semi-phosphorylative Entner-Doudoroff pathway, gluconate => glycerate-3P
Brite
KEGG Orthology (KO) [BR:hwa00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    HQ1394A (gapB)
   01230 Biosynthesis of amino acids
    HQ1394A (gapB)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    HQ1394A (gapB)
Enzymes [BR:hwa01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.12  glyceraldehyde-3-phosphate dehydrogenase (phosphorylating)
     HQ1394A (gapB)
Exosome [BR:hwa04147]
 Exosomal proteins
  Proteins found in most exosomes
   HQ1394A (gapB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
491629..492717
Genome map
AA seq 362 aa AA seqDB search
MYEVYSNMSEKSNLSANPSTNPIRVGLNGFGRIGRSVLRAIITNPSIELVGINDVMEFDD
MGYLAKYDTVMGRADDISQDGNMLSVGETTVPLYNIQDPTELPWGQLEVDVTLECTGIFR
TRSDAAAHLEAGADKVIISAPPKGDEPVKQIVYGVNHHEYTGEDILSNASCTTNSVSPVA
KVLDDEFEIESGLLTTVHAYTGSQALIDSPMTKTRRGRAAAENIIPTSTGAAQATTEVLP
QLDGKLDGMAMRVPVPNGSITELVVNLSTAPSVEVVNDAFRNAADDGPLAGVLGYTDDEV
VSSDIIGLPFSSMVDLNSTNQVNAGGLYKILTWYDNEFGFSNRMLDLAQFITNTNTNTST
NT
NT seq 1089 nt NT seq  +upstreamnt  +downstreamnt
atgtatgaagtgtactcgaatatgagtgaaaaatcgaatttatctgctaatccaagcaca
aatccgattcgggttggattgaacggatttggtcggattgggcgaagcgttctccgggca
attattactaatccatcaattgagcttgtcggaataaacgatgtgatggaattcgatgat
atgggttatttagcgaagtatgatacagttatgggtcgagctgatgatatctcacaggat
gggaacatgcttagcgttggcgagacaaccgtaccactgtataatatccaagatccgacg
gaattgccatggggtcaacttgaggtagacgtcacacttgagtgtacgggcatttttcga
acccggtcagacgccgcggcacatctagaagcaggggcagataaggtgattatctctgca
ccgccgaagggtgatgagccagtcaagcaaattgtgtatggtgtcaatcatcacgaatat
accggtgaggatattctctcaaatgcatcttgtacgaccaactccgttagtccagtcgcg
aaagtcctcgatgatgaattcgaaatcgaaagtggtcttttgaccactgtccacgcatac
actggaagtcaagcacttatcgatagtcctatgacaaagacgcgacggggacgggcagct
gcagagaatattattccaacctcaacaggagccgcacaagcgaccacagaggtacttccg
cagcttgatggtaaactcgatggaatggcaatgcgtgttccagtgccgaacgggtcaatt
acagagttggtggttaatctatcgactgcgccaagtgttgaagtcgtaaatgatgcattc
cgcaatgctgctgatgatggcccacttgctggtgtactgggctatactgatgatgaggtg
gtctcatcagatatcattggacttccattctcctcgatggtcgatcttaattcgaccaat
caggtaaatgcaggaggactttataagattctcacgtggtatgataacgaattcggcttt
tcaaaccggatgcttgatcttgcacaattcatcacgaatacgaacacaaatacgagtaca
aatacataa

DBGET integrated database retrieval system