KEGG   Haloquadratum walsbyi DSM 16790: HQ1394AHelp
Entry
HQ1394A           CDS       T00375                                 

Gene name
gapB
Definition
glyceraldehyde-3-phosphate dehydrogenase (NAD(P)) (phosphorylating) (EC:1.2.1.59)
Orthology
K00134  
glyceraldehyde 3-phosphate dehydrogenase [EC:1.2.1.12]
Organism
hwa  Haloquadratum walsbyi DSM 16790
Pathway
Glycolysis / Gluconeogenesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis, core module involving three-carbon compounds
Semi-phosphorylative Entner-Doudoroff pathway, gluconate => glycerate-3P
Class
Metabolism; Overview; Carbon metabolism [PATH:hwa01200]
Metabolism; Overview; Biosynthesis of amino acids [PATH:hwa01230]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:hwa00010]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
491629..492717
Genome map
AA seq 362 aa AA seqDB search
MYEVYSNMSEKSNLSANPSTNPIRVGLNGFGRIGRSVLRAIITNPSIELVGINDVMEFDD
MGYLAKYDTVMGRADDISQDGNMLSVGETTVPLYNIQDPTELPWGQLEVDVTLECTGIFR
TRSDAAAHLEAGADKVIISAPPKGDEPVKQIVYGVNHHEYTGEDILSNASCTTNSVSPVA
KVLDDEFEIESGLLTTVHAYTGSQALIDSPMTKTRRGRAAAENIIPTSTGAAQATTEVLP
QLDGKLDGMAMRVPVPNGSITELVVNLSTAPSVEVVNDAFRNAADDGPLAGVLGYTDDEV
VSSDIIGLPFSSMVDLNSTNQVNAGGLYKILTWYDNEFGFSNRMLDLAQFITNTNTNTST
NT
NT seq 1089 nt NT seq  +upstreamnt  +downstreamnt
atgtatgaagtgtactcgaatatgagtgaaaaatcgaatttatctgctaatccaagcaca
aatccgattcgggttggattgaacggatttggtcggattgggcgaagcgttctccgggca
attattactaatccatcaattgagcttgtcggaataaacgatgtgatggaattcgatgat
atgggttatttagcgaagtatgatacagttatgggtcgagctgatgatatctcacaggat
gggaacatgcttagcgttggcgagacaaccgtaccactgtataatatccaagatccgacg
gaattgccatggggtcaacttgaggtagacgtcacacttgagtgtacgggcatttttcga
acccggtcagacgccgcggcacatctagaagcaggggcagataaggtgattatctctgca
ccgccgaagggtgatgagccagtcaagcaaattgtgtatggtgtcaatcatcacgaatat
accggtgaggatattctctcaaatgcatcttgtacgaccaactccgttagtccagtcgcg
aaagtcctcgatgatgaattcgaaatcgaaagtggtcttttgaccactgtccacgcatac
actggaagtcaagcacttatcgatagtcctatgacaaagacgcgacggggacgggcagct
gcagagaatattattccaacctcaacaggagccgcacaagcgaccacagaggtacttccg
cagcttgatggtaaactcgatggaatggcaatgcgtgttccagtgccgaacgggtcaatt
acagagttggtggttaatctatcgactgcgccaagtgttgaagtcgtaaatgatgcattc
cgcaatgctgctgatgatggcccacttgctggtgtactgggctatactgatgatgaggtg
gtctcatcagatatcattggacttccattctcctcgatggtcgatcttaattcgaccaat
caggtaaatgcaggaggactttataagattctcacgtggtatgataacgaattcggcttt
tcaaaccggatgcttgatcttgcacaattcatcacgaatacgaacacaaatacgagtaca
aatacataa

DBGET integrated database retrieval system