KEGG   Haloquadratum walsbyi DSM 16790: HQ1474AHelp
Entry
HQ1474A           CDS       T00375                                 

Gene name
rbsK
Definition
ribokinase (EC:2.7.1.15)
Orthology
K00852  
ribokinase [EC:2.7.1.15]
Organism
hwa  Haloquadratum walsbyi DSM 16790
Pathway
Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:hwa00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    HQ1474A (rbsK)
Enzymes [BR:hwa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     HQ1474A (rbsK)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(587511..588587)
Genome map
AA seq 358 aa AA seqDB search
MPDVISLGSINVDRIHHVSADVLKGLTSAHAWFPDQGETIIHDVESLPSSIPTPPDMVQY
GGKGANQAIAATKAGAQTTLLGVVGSDAESTDVCEHLSEFGVNIDNVRSAAMPTGTADIF
IDPDGNNRIIVRPGANKKVDIDYIDTHFETIIESNCLLIQNEIPPDPVTHLLDRLAASNN
SPTVLFDPAPAGGADKLLHPGAIDYVTPNETEYTALKPALSEYDGVLIRKAGGDDVIVEI
PDYLTLSPPRIIPDESESDIPDQIHVTTNPEDETQTEGRIPDSTRLSITPPAVETVDTTG
AGDVLSGYLAARLPVEKSLLQAVEKAIIAGSLSTQHAGAQNGIPALSTVQEFQSNNRH
NT seq 1077 nt NT seq  +upstreamnt  +downstreamnt
atgcctgacgtaatcagtcttggtagcattaacgtggatcggattcatcacgtctcagct
gacgtgctcaaaggtctcacatcagcgcatgcatggtttccggatcagggcgaaacaatt
attcatgatgtcgaatcgctcccgtcatcgatcccgacaccgccagatatggtacaatat
ggtgggaaaggagcaaaccaggctatagctgcaacaaaggcgggggctcaaacaacgctt
cttggtgttgttgggtctgatgcggaaagcacagacgtttgtgaacatctcagtgaattc
ggtgtcaatatcgataatgtgcggtcagcagcaatgccaactgggaccgcagatattttt
attgatcccgacggtaataaccgtattatagtccgccccggtgccaacaagaaagttgat
atcgactatattgatacacacttcgagacgattattgagagtaactgtctcttgattcaa
aatgagatcccgccagatccagtcactcacttacttgatcggcttgcggcgagtaacaat
tcaccaactgtcttgtttgatcccgctcccgccggtggcgctgataaactgcttcacccg
ggcgctattgactatgtgacaccaaatgagactgaatacacagcactcaaaccagcactc
agtgagtacgatggtgtccttattcgcaaagcaggtggtgatgacgttattgtcgagata
ccggactatcttaccctctctccccctcgaataattcctgatgagtctgagtctgatatc
cccgatcagatacatgtgacaacgaacccagaagatgaaactcaaaccgaaggaagaata
ccggattcaactcgattatcgattacacctcctgcggttgagacagtcgatacgacaggt
gctggtgatgttcttagcggttatcttgctgctcggcttccggtggaaaagtcactatta
caggcagtcgagaaagcgattattgctggatcattatcgacgcagcatgctggcgcacaa
aacgggattccagcgctatcgaccgttcaagagtttcaatcaaataaccggcattaa

DBGET integrated database retrieval system