KEGG   Haloquadratum walsbyi DSM 16790: HQ1538AHelp
Entry
HQ1538A           CDS       T00375                                 

Gene name
acs
Definition
acyl-CoA synthetase (EC:6.2.1.1)
Orthology
K01895  
acetyl-CoA synthetase [EC:6.2.1.1]
Organism
hwa  Haloquadratum walsbyi DSM 16790
Pathway
Glycolysis / Gluconeogenesis
Pyruvate metabolism
Propanoate metabolism
Methane metabolism
Carbon fixation pathways in prokaryotes
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:hwa00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    HQ1538A (acs)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    HQ1538A (acs)
   00620 Pyruvate metabolism
    HQ1538A (acs)
   00640 Propanoate metabolism
    HQ1538A (acs)
  Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    HQ1538A (acs)
   00680 Methane metabolism
    HQ1538A (acs)
Enzymes [BR:hwa01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     HQ1538A (acs)
Lipid biosynthesis proteins [BR:hwa01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   HQ1538A (acs)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
660093..662072
Genome map
AA seq 659 aa AA seqDB search
MTDDDVELEARLAEQESFDPPASFVDQANVTDEAIYDEFSENWPECWTRAADLLSWDSEY
STVLDDSDEPFYEWFADGDLNAAYNCVDRHVEDGNKNRVAIKWEGEHGNTRTYTYQDLYR
EVNEFAATLQELGVKENDVVTMYMPMIPELPIAMLACARIGAPHSVVFAGFSADALATRM
NSADSEYLITADGYYRRGDALDHFQKAQEGLDNVEHDVAASVVVDRLGDDGFGHELSETQ
YDWDSLMDAHRGDRVAPVERNAEDMLFLMYTSGTTGEPKGVKHTTGGYLAYTAWTAQSVL
DLEPGDTYWCSADIGWITGHSYIVYGPLALGTTTVMYEGTPDYPERDRLWDIIEKYAVDV
FYTAPTAIRAFMKWGTEYPDSHDLSSLRLLGTVGEPINPRAWKWYYTHIGHESCPIVDTW
WQTETGGMMVTTLPGIGTMKPGSAGPPSPGIDATIVDTAGEDVDAGRAGYLTVNKPWPGM
LRTLYQNDERFIDEYWEEYSDPDTDEWVYFPEDGAKIDDDGYMTILGRVDDVLNVSGHRL
GTMEIESAIVGVNGVAEAAVVGGDHDLKGEAVYAYVITEDGYAEDEDLRESIIKGVEDGI
GPIARPEQVIFTEELPKTRSGKIMRRLLEEIANGEELGDTTTLRNPEIVDEIEAKVSGD
NT seq 1980 nt NT seq  +upstreamnt  +downstreamnt
atgacagatgacgatgtcgaactcgaggcacgccttgctgagcaggaaagctttgatccg
ccggcgtcgtttgtcgatcaggcaaacgtcacagacgaggccatttatgatgagttctct
gaaaattggcctgagtgttggactcgcgcggctgatctgctttcttgggacagtgaatac
tcgactgttcttgatgactcagatgagccgttctacgaatggttcgctgatggtgatctg
aacgccgcatataattgcgttgaccggcatgtcgaagacggcaataaaaaccgggttgca
attaagtgggaaggtgaacacggtaacactcgcacgtatacatatcaagatctgtatcgt
gaagtgaatgaatttgctgccacactgcaggaacttggggtgaaagaaaacgatgttgtc
acgatgtatatgccaatgattcctgagcttccgattgcaatgcttgcatgtgcacgcatt
ggtgccccacactcagttgtgtttgctggattctccgcagatgcgcttgcaacgcggatg
aattctgccgactctgaatatctcatcaccgccgatggatattatcgacgcggtgatgca
cttgatcacttccagaaagcacaagaaggacttgataatgttgagcacgatgtcgccgca
agcgttgttgtggaccgtcttggcgatgacggattcggtcatgaactgagtgaaacgcag
tatgactgggactcactcatggatgcacaccgcggtgaccgagttgcacccgttgagcga
aatgctgaggatatgctgtttttgatgtacacttctggtacaactggcgaaccaaaaggt
gttaaacacacaactggcggttatcttgcttacaccgcctggacagcacaatcagtgtta
gatcttgaacctggtgacacctactggtgctcagctgacattggctggattaccggacat
tcatatattgtttacggtccactcgcattgggcacgacaacggtcatgtatgagggaaca
ccggattaccccgagcgagatcgactctgggatattattgaaaaatacgccgttgatgtg
ttctatacggctccaacagcaatccgagccttcatgaagtggggtacggaatatcctgac
tctcatgatttatcaagtcttcggctgcttggaactgttggcgaaccgattaatccacgc
gcatggaaatggtattatacccatatcggtcatgagtcttgcccgattgtcgatacatgg
tggcagacagaaacaggcggaatgatggttacgactctcccaggcattgggacaatgaaa
ccaggttctgccggtccaccctcgccaggaatcgatgcgacaattgttgataccgctggt
gaggacgttgatgcaggtcgggcaggatatctcacggtgaataaaccatggccggggatg
cttcgaacgctgtatcagaatgatgaacggttcattgatgaatactgggaggagtattcc
gacccagataccgatgaatgggtgtatttcccagaggatggcgccaagatcgacgatgac
ggctatatgacaatattggggcgggttgatgatgtactcaatgtatcaggacatcggctc
ggaaccatggagattgagtcagcaatcgtcggtgtgaatggtgttgcagaagcagcagtc
gttggcggtgatcatgatctgaaaggtgaggctgtatatgcatatgtcatcactgaagac
ggatatgctgaagatgaggacctaagagaatcaatcatcaaaggcgttgaagatggaatc
ggtccgattgcacgaccagaacaagttatatttaccgaggaactaccaaaaacgcgatca
ggtaaaattatgcgacgcctccttgaggagattgcaaacggtgaagaattgggagacaca
acaacactcagaaacccagaaattgttgacgaaatcgaggcaaaagtcagtggcgattga

DBGET integrated database retrieval system