KEGG   Haloquadratum walsbyi DSM 16790: HQ1729AHelp
Entry
HQ1729A           CDS       T00375                                 

Gene name
adh
Definition
alcohol dehydrogenase (EC:1.1.1.1 1.1.1.2)
Orthology
K00001  
alcohol dehydrogenase [EC:1.1.1.1]
K00002  
alcohol dehydrogenase (NADP+) [EC:1.1.1.2]
Organism
hwa  Haloquadratum walsbyi DSM 16790
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Glycerolipid metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:hwa00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    HQ1729A (adh)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    HQ1729A (adh)
  Lipid metabolism
   00071 Fatty acid degradation
    HQ1729A (adh)
   00561 Glycerolipid metabolism
    HQ1729A (adh)
  Amino acid metabolism
   00350 Tyrosine metabolism
    HQ1729A (adh)
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    HQ1729A (adh)
   00930 Caprolactam degradation
    HQ1729A (adh)
   00626 Naphthalene degradation
    HQ1729A (adh)
Enzymes [BR:hwa01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     HQ1729A (adh)
    1.1.1.2  alcohol dehydrogenase (NADP+)
     HQ1729A (adh)
Exosome [BR:hwa04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   HQ1729A (adh)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
887833..889860
Genome map
AA seq 675 aa AA seqDB search
MQCAFIGAGDVVDYYLNNFDSTSLELTAVCDHDGARARHLAALTDATAYTDLESLLSTES
APLIVNLTSHQAHADVTRQCLNADRHVFTEKPLALDADTATALVDLAKQRGVGLDCAPIN
HRGQAQQHIGSLLADDQLNPIRVIYAHAHAGRVTEWHDNPESFLAVGPLYDSAVYPLTLL
TEWFGPVETVRTADTIDVYPSHAESTPERPAHVEATLTLAAGPIIRLTTSFYTPHRSREF
NSIELHGDGGSVYLNDSGSLTATAQSVSVGGHGRSYVTAPPITSSSQNHSHISGPARFAR
AIEHGDRPVTGGQRGAHIVRVCNAIEHAAANNVSVSLSSPELRCTESRDEHAYARSLRAL
RQDTYTSQSHTNPKSSEMNLQRHNSHRLPPVGFGCSRYRNGNYIDRVDSIATAIDAGYRL
FDMAELYGNEYRIGSLLETPGTPSRDQLVLISKVWNTNHAHIAEACNGTLSELGIETLDS
YLLHWPDAWAYQGPLSKLATLSPEQQEERTFPTDASGNRASADVSIESAWQRLEEVCRRG
LTRTIGICNISAIELQRILDIASIPPAIVQIESHPYRPRNELIEKCHMNGIRVIAHSPLS
APGLLTEPVLQTIADTHDVSPAAIAISYHVDRGVIPIPSSTTAKHISANLAAANIQLSDE
ERNRLQTLADTEFER
NT seq 2028 nt NT seq  +upstreamnt  +downstreamnt
atgcaatgtgcgttcatcggtgctggtgatgtcgttgattattatcttaataactttgat
tcgacttcacttgagctgacagcggtctgtgatcatgatggtgcccgcgcgagacatctt
gcagcgttaactgatgcaacagcttatactgatcttgaatcattgctatcgaccgagtca
gcaccgcttattgtgaatcttacgagtcatcaagcacatgcggacgtcacacgccaatgt
ttaaatgccgatcgacatgtctttactgagaaaccgcttgcactggacgccgatactgca
acagcactcgttgatctcgccaaacaacgcggagtaggtcttgattgtgccccgattaac
catcgtggacaagcacaacagcatattggatcactccttgctgatgatcaattgaatcca
attcgtgtcatatatgctcacgctcatgcaggtcgtgtcacagaatggcatgataatcca
gagtcattccttgccgttggtccactatacgacagtgctgtgtacccacttacattactt
accgaatggtttggtcctgttgagacggttcggactgcagatacaattgatgtctatcca
tcacacgctgagtcaacccccgaacgccccgcacatgttgaggcgacacttacactcgct
gctggaccaattattagacttacaacaagcttctatacgccacatcggagtcgtgaattc
aattcgattgagctccatggcgatggtggttcagtatatctcaatgattccggttcgctg
acagctactgctcaaagcgtcagcgtcggcggtcacggtcgatcatacgtcactgcgcca
ccgatcacatcatcatcacagaatcattcacatatctctggaccagcacgttttgcacgg
gcaattgaacacggagatcgaccagtgacaggtggtcaacgaggtgcgcatatcgttcgt
gtctgtaatgcaattgaacatgcggctgcaaataatgtatctgtatcactctcatcacca
gaactgagatgcactgagtcaagagatgaacatgcatatgcccgatcattaagagcgctt
cggcaggatacatacacatcacagtcacatacaaacccaaagagttctgagatgaatcta
caacggcataatagtcatcgactgccacctgttggctttggatgctcacgataccgtaat
gggaattatattgatcgtgtcgactctatcgcaacagcaattgacgctggctatcggcta
tttgacatggcagaactgtatggtaatgaatatcgtatcgggtcattgcttgagacacca
gggacaccatcccgtgatcaactcgtgctgataagtaaggtctggaatacaaatcatgca
catattgcagaggcatgtaatggaacgctctcagaactcggtatcgagacgcttgattca
tatctccttcactggccagatgcatgggcttaccaaggaccattatcaaaacttgcaacc
ctctcgccagagcaacaagaggagcgaacattcccgactgatgcctccggtaatcgcgcg
tctgctgatgtctcaattgaatctgcatggcaacggcttgaagaagtctgccgccgtggg
ctcacacgcacaatcggaatttgtaatatctctgcgatagaacttcaacgaattcttgat
attgcatcaattcccccagcaattgtccaaattgagtcacatccatatcgaccgcgtaat
gaactgattgaaaaatgtcatatgaatggtattcgtgtgattgcacattcaccgttgtct
gctcctggattactcacagagccggtattacaaaccattgcagatacgcatgatgtttca
ccagcagccattgcaatatcgtatcacgtcgataggggtgttatcccaattccttcgagc
acgacagcaaaacatatttcagcgaatcttgcagcagcgaatatccaacttagtgatgag
gaacgaaacaggctccagacacttgcagatacagagtttgaacgatga

DBGET integrated database retrieval system