KEGG   Haloquadratum walsbyi DSM 16790: HQ1798AHelp
Entry
HQ1798A           CDS       T00375                                 

Gene name
hat
Definition
histone acetyltransferase-like protein
Orthology
K07739  
elongator complex protein 3 [EC:2.3.1.48]
Organism
hwa  Haloquadratum walsbyi DSM 16790
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
979438..981147
Genome map
AA seq 569 aa AA seqDB search
MSTETDTEDTGSEPDPTETEAFRSTCKHLVEQIVAGDVDRDSLESAKLDACSQYGSPKVP
KNTDILSHASAANRDDVKSVVRRKPVRTASGVSPIAIMTSPHMCPHGKCLYCPGGPASEF
DSAQSYTGHEPAAARGKQNEYDPYGQVTLRLEQLRHIGHPVDKVELIIMGGTMTSRSHDY
QEWFLKRALEAMNDYDTDSKPDPASDQSFKPDPEDVEFRYLEDVIAENETADIRNIGTTF
ETKPDWCDPEQIDRMLDLGATKVEVGVQTTYERINREMHRGHGVQASIDANQRLRDAGFK
VGFHMMPGQPGMTSKMIREDFRQLFNRTEYRPDYLKIYPTLVVRGTRVYDQWRRDDFEPL
DNETAAEIIAEVMGMIPEYTRLQRVQRDIPADFIDAGVWKSNLRQLASQRADEKGIEIRD
IRAREAGLNETDPDPEHIELNEMTYDVAGGTEHFLKFEDSYADLLIGFCRLRFPGATVRR
ELKNAAVVRELHVYGSEAGIGATANKSESTGDTAWQHKGYGKRLITRAEELAREAGYDSL
AIISGIGARQYYRQKLGYHQDGPYVAKKL
NT seq 1710 nt NT seq  +upstreamnt  +downstreamnt
gtgagcactgaaacagacacagaagacacgggatcagagcctgacccaacggagacggaa
gcattccgcagcacctgtaagcatcttgtcgagcaaatcgtcgcaggtgatgtcgaccgc
gatagtctcgagtcggcaaaactagatgcttgttcacaatatgggtcaccaaaggttcca
aaaaacacagatatcctttcacatgcctccgcggcgaatcgcgatgatgtcaaatccgtt
gtgcggcggaagcctgtccggaccgcatcaggtgtctcaccaattgcgataatgacttct
ccgcacatgtgtccgcatggtaaatgcctatattgtccaggcggtcctgcaagtgagttt
gattccgcacagagttacactggacatgaacctgctgcagcacgtggcaagcagaatgaa
tacgacccatatggtcaggtaacactccgacttgagcaacttcgacacatcggacacccg
gttgataaagtcgaactcattattatggggggaacaatgacttcacggagtcatgattat
caagaatggttcctcaagcgtgcgcttgaagcgatgaatgattatgatactgattcaaaa
ccggatcctgcatctgatcaatcatttaaacctgatccggaagatgttgaatttcggtat
cttgaagacgtcattgcggagaatgagactgcagatattcggaatatcgggacaaccttt
gaaacaaaaccggactggtgtgacccagaacagatcgaccggatgcttgaccttggtgcg
acaaaagtcgaggttggcgtgcagacaacctatgaacggattaatcgcgaaatgcatcga
ggacatggtgtgcaagcatcaatcgatgcaaaccaacgactccgcgatgccggattcaaa
gttggcttccatatgatgcctggacaaccagggatgacgtctaagatgatccgcgaagac
ttccgacaactgttcaatcgcaccgaatatcgtcctgattatctgaagatctacccaaca
cttgttgtacgcggaactcgcgtatatgatcaatggcggcgcgatgattttgaaccactt
gataatgaaacagccgcagaaataatcgcagaggtaatggggatgattccagaatatacg
cgccttcagcgtgttcaacgtgatatccctgcagatttcattgatgctggtgtatggaag
tctaacctgagacaattagccagtcaacgtgctgatgagaagggaattgagattcgtgat
attagggcacgtgaggcaggattgaatgaaactgaccctgatcctgagcatattgaattg
aatgaaatgacatatgatgtagctggcgggaccgaacacttcctcaagtttgaagattcg
tatgcagatctgctcattggattctgccgacttcgattcccaggagcaacagttcgtcgc
gaacttaaaaacgctgctgtggtccgagaactacatgtatatggaagtgaggcaggaatt
ggagcaacagctaataaatccgaatctactggagatactgcttggcaacataaggggtat
ggaaaacggcttattactcgtgctgaggagctggcacgtgaggctgggtatgattcactt
gcaattatctcgggaatcggtgctcgacagtactatcggcagaaacttgggtatcatcag
gacggaccgtacgttgcaaagaaattatga

DBGET integrated database retrieval system